You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ELOVL4
Elongation of very long chain fatty acids protein 4

Protein Summary
Description
Catalyzes the first and rate-limiting reaction of the four that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. Condensing enzyme that specifically elongates C24:0 and C26:0 acyl-CoAs. May participate in the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. May play a critical role in early brain and skin development. This gene encodes a membrane-bound protein which is a member of the ELO family, proteins which participate in the biosynthesis of fatty acids. Consistent with the expression of the encoded protein in photoreceptor cells of the retina, mutations and small deletions in this gene are associated with Stargardt-like macular dystrophy (STGD3) and autosomal dominant Stargardt-like macul ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369816
  • ENSP00000358831
  • ENSG00000118402

Symbol
  • ADMD
  • CT118
  • ISQMR
  • SCA34
  • STGD2
  • STGD3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
phenotype
0.73
microRNA
0.68
histone modification site profile
0.66
kinase perturbation
0.66
tissue sample
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 114.11   (req: < 5)
Gene RIFs: 34   (req: <= 3)
Antibodies: 225   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 114.11   (req: >= 5)
Gene RIFs: 34   (req: > 3)
Antibodies: 225   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (13)
Fatty acid metabolism (R-HSA-8978868)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Fatty acid metabolism
Reactome
Fatty acyl-CoA biosynthesis
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Synthesis of very long-chain fatty acyl-CoAs
Name
Explore in Pharos
Explore in Source
Fatty acid metabolism
Fatty acyl-CoA biosynthesis
Metabolism
Metabolism of lipids
Synthesis of very long-chain fatty acyl-CoAs
Gene Ontology Terms (16)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (58)
1 – 10 of 58
SLC7A14
Tbio
Family: Transporter
Novelty: 0.17811121
p_int: 0.924875674
p_ni: 0.006192131
p_wrong: 0.068932195
Data Source: BioPlex
SLC7A1
Tbio
Family: Transporter
Novelty: 0.00093544
p_int: 0.817840709
p_ni: 0.032923206
p_wrong: 0.149236086
Score: 0.244
Data Source: BioPlex,STRINGDB
HSD17B12
Tbio
Family: Enzyme
Novelty: 0.03532677
Score: 0.963
Data Source: STRINGDB
IMPG1
Tbio
Novelty: 0.05141388
Score: 0.93
Data Source: STRINGDB
TENT5A
Tbio
Novelty: 0.10907364
Score: 0.906
Data Source: STRINGDB
ABCA4
Tbio
Family: Transporter
Novelty: 0.00172679
Score: 0.8
Data Source: STRINGDB
CERS3
Tbio
Family: TF
Novelty: 0.06580864
Score: 0.666
Data Source: STRINGDB
LINS1
Tbio
Novelty: 0.01082837
Score: 0.663
Data Source: STRINGDB
CNGB3
Tchem
Family: IC
Novelty: 0.0156591
Score: 0.65
Data Source: STRINGDB
CLEC2D
Tbio
Novelty: 0.03470529
Score: 0.642
Data Source: STRINGDB
Publication Statistics
PubMed Score  114.11

PubMed score by year
PubTator Score  76.09

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDR
1-70
EPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYL
70-140
DTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQK
140-210
YLWWKRYLTMLQLIQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKAGK
210-280
TAMNGISANGVSKSEKQLMIENGKKQKNGKAKGD
280-314
MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLIQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKAGKTAMNGISANGVSKSEKQLMIENGKKQKNGKAKGD