You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
COMMD5
COMM domain-containing protein 5

Protein Summary
Description
May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis (By similarity). Down-regulates activation of NF-kappa-B (PubMed:15799966).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000305103
  • ENSP00000304544
  • ENSG00000170619
  • ENST00000402718
  • ENSP00000385793
  • ENST00000450361
  • ENSP00000394331
  • ENST00000543949
  • ENSP00000445840

Symbol
  • HCARG
  • HT002
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.91
kinase perturbation
0.71
tissue sample
0.66
cell type or tissue
0.61
histone modification site profile
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.04   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 35   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.04   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 35   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Neddylation
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Neddylation
Post-translational protein modification
Gene Ontology Terms (2)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Protein-Protein Interactions (205)
1 – 10 of 205
COMMD8
Tdark
Novelty: 0.59659091
p_int: 0.999999965
p_ni: 3.5e-8
Score: 0.995
Data Source: BioPlex,STRINGDB
COMMD3
Tbio
Novelty: 0.00979181
p_int: 0.999999952
p_ni: 4.8e-8
Score: 0.993
Data Source: BioPlex,STRINGDB
COMMD1
Tbio
Novelty: 0.01478186
p_int: 0.999999899
p_ni: 1.01e-7
Score: 0.997
Data Source: BioPlex,STRINGDB
COMMD2
Tdark
Novelty: 4
p_int: 0.999999866
p_ni: 1.34e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
COMMD10
Tdark
Novelty: 0.26481715
p_int: 0.999999758
p_ni: 2.42e-7
Score: 0.995
Data Source: BioPlex,STRINGDB
COMMD6
Tbio
Novelty: 0.11964195
p_int: 0.999999592
p_ni: 4.08e-7
Score: 0.994
Data Source: BioPlex,STRINGDB
COMMD4
Tdark
Novelty: 0.99837925
p_int: 0.999999384
p_ni: 5.87e-7
p_wrong: 2.8e-8
Score: 0.994
Data Source: BioPlex,STRINGDB
CCDC22
Tbio
Novelty: 0.01857112
p_int: 0.999997695
p_ni: 0.000002305
Score: 0.993
Data Source: BioPlex,STRINGDB
FAM45A
Tdark
Novelty: 2
p_int: 0.999984245
p_ni: 0.000015755
Score: 0.855
Data Source: BioPlex,STRINGDB
VPS29
Tbio
Novelty: 0.02138387
p_int: 0.999977309
p_ni: 0.000022691
Score: 0.872
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  9.04

PubMed score by year
PubTator Score  5.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR
1-70
LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS
70-140
VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE
140-210
MADLEKRCERRLQD
210-224
MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKRCERRLQD