You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NRSN2
Neurensin-2

Protein Summary
Description
May play a role in maintenance and/or transport of vesicles.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000382285
  • ENSP00000371722
  • ENSG00000125841
  • ENST00000382291
  • ENSP00000371728
  • ENST00000621012
  • ENSP00000482706

Symbol
  • C20orf98
  • C20orf98
  • dJ1103G7.6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.62
small molecule perturbation
0.59
cell type or tissue
0.54
histone modification site profile
0.53
cellular component
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.78   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 164   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.78   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 164   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (7)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
LIFEdb
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (27)
1 – 10 of 27
CD1B
Tbio
Novelty: 0.00152228
p_int: 0.999773873
p_ni: 0.000183493
p_wrong: 0.000042634
Score: 0.179
Data Source: BioPlex,STRINGDB
FAM234B
Tdark
Novelty: 9.9
p_int: 0.999643654
p_ni: 0.000165682
p_wrong: 0.000190664
Score: 0.186
Data Source: BioPlex,STRINGDB
FITM2
Tdark
Novelty: 0.02272483
p_int: 0.854995215
p_ni: 0.125395719
p_wrong: 0.019609066
Score: 0.161
Data Source: BioPlex,STRINGDB
MANSC1
Tdark
Novelty: 1.42372881
p_int: 0.805439615
p_ni: 0.002520866
p_wrong: 0.192039519
Data Source: BioPlex
ZDHHC17
Tbio
Family: Enzyme
Novelty: 0.03352984
p_int: 0.757418258
p_ni: 0.242581718
p_wrong: 2.4e-8
Score: 0.214
Data Source: BioPlex,STRINGDB
ZBBX
Tdark
Novelty: 5.95833333
Score: 0.732
Data Source: STRINGDB
WDR49
Tdark
Score: 0.667
Data Source: STRINGDB
ARMCX2
Tdark
Novelty: 0.26022305
Score: 0.651
Data Source: STRINGDB
NECAP2
Tdark
Novelty: 0.58353317
Score: 0.636
Data Source: STRINGDB
FSTL5
Tbio
Novelty: 0.14507772
Score: 0.627
Data Source: STRINGDB
Publication Statistics
PubMed Score  4.78

PubMed score by year
PubTator Score  3.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSLCWKISLSSGT
1-70
LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGTALCVAAGVLLAICLFWAMIG
70-140
WLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQSWFSPPASPFGQSSVQTIQPKRDS
140-204
MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSLCWKISLSSGTLLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGTALCVAAGVLLAICLFWAMIGWLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQSWFSPPASPFGQSSVQTIQPKRDS