You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TTYH3
Protein tweety homolog 3

Protein Summary
Description
Probable large-conductance Ca(2+)-activated chloride channel. May play a role in Ca(2+) signal transduction. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-activated large conductance chloride(-) channel. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000258796
  • ENSP00000258796
  • ENSG00000136295
  • ENST00000403167
  • ENSP00000385015
  • ENST00000407643
  • ENSP00000385316

Symbol
  • KIAA1691
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor
0.8
transcription factor perturbation
0.74
transcription factor binding site profile
0.7
molecular function
0.63
cellular component
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.56   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 23   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.56   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 23   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Ion channel transport (R-HSA-983712)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Ion channel transport
Reactome
Stimuli-sensing channels
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Ion channel transport
Stimuli-sensing channels
Transport of small molecules
Protein-Protein Interactions (93)
1 – 10 of 93
P2RY12
Tclin
Family: GPCR
Novelty: 0.00057146
p_int: 0.997657809
p_ni: 0.002342191
Data Source: BioPlex
CD70
Tbio
Novelty: 0.00552433
p_int: 0.996884432
p_ni: 0.003115568
Data Source: BioPlex
CD226
Tbio
Novelty: 0.00453644
p_int: 0.994172148
p_ni: 0.005827851
Data Source: BioPlex
CYP2J2
Tchem
Novelty: 0.00634057
p_int: 0.974605521
p_ni: 0.024524062
p_wrong: 0.000870417
Data Source: BioPlex
GPR141
Tdark
Family: GPCR
Novelty: 0.28510819
p_int: 0.960641163
p_ni: 0.039358837
Data Source: BioPlex
CDKAL1
Tbio
Family: Enzyme
Novelty: 0.01389805
p_int: 0.96030617
p_ni: 0.039693829
p_wrong: 2e-9
Score: 0.175
Data Source: BioPlex,STRINGDB
ASGR2
Tbio
Novelty: 0.35502959
p_int: 0.958694772
p_ni: 0.041305227
Data Source: BioPlex
TACR3
Tchem
Family: GPCR
Novelty: 0.00322406
p_int: 0.9280505
p_ni: 0.071948888
p_wrong: 6.12e-7
Data Source: BioPlex
CD27
Tbio
Novelty: 0.00109406
p_int: 0.925277923
p_ni: 0.074722077
Data Source: BioPlex
LPAR1
Tchem
Family: GPCR
Novelty: 0.004102
p_int: 0.921813837
p_ni: 0.078186163
Data Source: BioPlex
Publication Statistics
PubMed Score  1.56

PubMed score by year
PubTator Score  2.2

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAGVSYAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQALLLLGAAALACLALDLLFLLFYSFWLCC
1-70
RRRKSEEHLDADCCCTAWCVIIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTA
70-140
VGLNHTAEPSLQTLERQLAGRPEPLRAVQRLQGLLETLLGYTAAIPFWRNTAVSLEVLAEQVDLYDWYRW
140-210
LGYLGLLLLDVIICLLVLVGLIRSSKGILVGVCLLGVLALVISWGALGLELAVSVGSSDFCVDPDAYVTK
210-280
MVEEYSVLSGDILQYYLACSPRAANPFQQKLSGSHKALVEMQDVVAELLRTVPWEQPATKDPLLRVQEVL
280-350
NGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDGVEGLIYLALFSFVTALMFSSIVCSVPHTWQQKRGPD
350-420
EDGEEEAAPGPRQAHDSLYRVHMPSLYSCGSSYGSETSIPAAAHTVSNAPVTEYMSQNANFQNPRCENTP
420-490
LIGRESPPPSYTSSMRAKYLATSQPRPDSSGSH
490-523
MAGVSYAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQALLLLGAAALACLALDLLFLLFYSFWLCCRRRKSEEHLDADCCCTAWCVIIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTAVGLNHTAEPSLQTLERQLAGRPEPLRAVQRLQGLLETLLGYTAAIPFWRNTAVSLEVLAEQVDLYDWYRWLGYLGLLLLDVIICLLVLVGLIRSSKGILVGVCLLGVLALVISWGALGLELAVSVGSSDFCVDPDAYVTKMVEEYSVLSGDILQYYLACSPRAANPFQQKLSGSHKALVEMQDVVAELLRTVPWEQPATKDPLLRVQEVLNGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDGVEGLIYLALFSFVTALMFSSIVCSVPHTWQQKRGPDEDGEEEAAPGPRQAHDSLYRVHMPSLYSCGSSYGSETSIPAAAHTVSNAPVTEYMSQNANFQNPRCENTPLIGRESPPPSYTSSMRAKYLATSQPRPDSSGSH