You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZC3H12C
Probable ribonuclease ZC3H12C

Protein Summary
Description
May function as RNase and regulate the levels of target RNA species.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000278590
  • ENSP00000278590
  • ENSG00000149289
  • ENST00000528673
  • ENSP00000431821

Symbol
  • KIAA1726
  • MCPIP3
  • MCPIP3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
microRNA
0.85
tissue sample
0.78
transcription factor perturbation
0.74
histone modification site profile
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.8   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 50   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.8   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 50   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (2)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (31)
1 – 10 of 31
KBTBD3
Tdark
Novelty: 10
Score: 0.763
Data Source: STRINGDB
MYO3B
Tbio
Family: Kinase
Novelty: 0.14793942
Score: 0.713
Data Source: STRINGDB
JPH1
Tbio
Novelty: 0.01588321
Score: 0.688
Data Source: STRINGDB
SLC2A9
Tbio
Family: Transporter
Novelty: 0.00954304
Score: 0.672
Data Source: STRINGDB
CHMP2A
Tbio
Novelty: 0.00337804
Score: 0.661
Data Source: STRINGDB
NLN
Tbio
Family: Enzyme
Novelty: 0.00186409
Score: 0.58
Data Source: STRINGDB
PIK3CB
Tchem
Family: Kinase
Novelty: 0.00458119
Score: 0.572
Data Source: STRINGDB
ZC3HAV1L
Tdark
Novelty: 2
Score: 0.567
Data Source: STRINGDB
ZC3H15
Tbio
Novelty: 0.16901408
Score: 0.556
Data Source: STRINGDB
NEDD8
Tbio
Novelty: 0.00356055
Score: 0.551
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.80

PubMed score by year
PubTator Score  2.47

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPGGGSQEYGVLCIQEYRKNSKVESSTRNNFMGLKDHLGHDLGHLYVESTDPQLSPAVPWSTVENPSMDT
1-70
VNVGKDEKEASEENASSGDSEENTNSDHESEQLGSISVEPGLITKTHRQLCRSPCLEPHILKRNEILQDF
70-140
KPEESQTTSKEAKKPPDVVREYQTKLEFALKLGYSEEQVQLVLNKLGTDALINDILGELVKLGNKSEADQ
140-210
TVSTINTITRETSSLESQRSESPMQEIVTDDGENLRPIVIDGSNVAMSHGNKEVFSCRGIKLAVDWFLER
210-280
GHKDITVFVPAWRKEQSRPDALITDQEILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFESDGII
280-350
VSNDNYRDLANEKPEWKKFIDERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPIVPEHKKQPCPYGK
350-420
KCTYGHKCKYYHPERGSQPQRSVADELRAMSRNTAAKTANEGGLVKSNSVPCSTKADSTSDVKRGAPKRQ
420-490
SDPSIRTQVYQDLEEKLPTKNKLETRSVPSLVSIPATSTAKPQSTTSLSNGLPSGVHFPPQDQRPQGQYP
490-560
SMMMATKNHGTPMPYEQYPKCDSPVDIGYYSMLNAYSNLSLSGPRSPERRFSLDTDYRISSVASDCSSEG
560-630
SMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHK
630-700
PPLPHLALHLPHSAVGARSSCPGDYPSPPSSAHSKAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSR
700-770
QEGLGSWERPGYGIDAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNREK
770-840
IYINLCNIFPPDLVRIVMKRNPHMTDAQQLAAAILVEKSQLGY
840-883
MPGGGSQEYGVLCIQEYRKNSKVESSTRNNFMGLKDHLGHDLGHLYVESTDPQLSPAVPWSTVENPSMDTVNVGKDEKEASEENASSGDSEENTNSDHESEQLGSISVEPGLITKTHRQLCRSPCLEPHILKRNEILQDFKPEESQTTSKEAKKPPDVVREYQTKLEFALKLGYSEEQVQLVLNKLGTDALINDILGELVKLGNKSEADQTVSTINTITRETSSLESQRSESPMQEIVTDDGENLRPIVIDGSNVAMSHGNKEVFSCRGIKLAVDWFLERGHKDITVFVPAWRKEQSRPDALITDQEILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFESDGIIVSNDNYRDLANEKPEWKKFIDERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPIVPEHKKQPCPYGKKCTYGHKCKYYHPERGSQPQRSVADELRAMSRNTAAKTANEGGLVKSNSVPCSTKADSTSDVKRGAPKRQSDPSIRTQVYQDLEEKLPTKNKLETRSVPSLVSIPATSTAKPQSTTSLSNGLPSGVHFPPQDQRPQGQYPSMMMATKNHGTPMPYEQYPKCDSPVDIGYYSMLNAYSNLSLSGPRSPERRFSLDTDYRISSVASDCSSEGSMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHKPPLPHLALHLPHSAVGARSSCPGDYPSPPSSAHSKAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSRQEGLGSWERPGYGIDAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNREKIYINLCNIFPPDLVRIVMKRNPHMTDAQQLAAAILVEKSQLGY