You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
UCK2
Uridine-cytidine kinase 2

Protein Summary
Description
Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine. This gene encodes a pyrimidine ribonucleoside kinase. The encoded protein (EC 2.7.1.48) catalyzes phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively.[provided by RefSeq, Oct 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000367879
  • ENSP00000356853
  • ENSG00000143179
  • ENST00000469256
  • ENSP00000476692
  • ENST00000470820
  • ENSP00000476327

Symbol
  • UMPK
  • UK
  • UMPK
  • TSA903
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.99
kinase perturbation
0.97
transcription factor binding site profile
0.95
PubMedID
0.92
molecular function
0.9


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 34.35   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 177   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 34.35   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 177   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of nucleotides
Reactome
Nucleotide salvage
Reactome
Pyrimidine salvage
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of nucleotides
Nucleotide salvage
Pyrimidine salvage
Gene Ontology Terms (8)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (79)
1 – 10 of 79
UPRT
Tbio
Family: Enzyme
Novelty: 0.00658607
p_int: 0.999999997
p_ni: 3e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
UCK1
Tbio
Family: Kinase
Novelty: 0.15864931
p_int: 0.999997988
p_wrong: 0.000002012
Score: 0.97
Data Source: BioPlex,STRINGDB
UCKL1
Tdark
Family: Kinase
Novelty: 0.22483758
p_int: 0.99998485
p_ni: 0.000015149
p_wrong: 1e-9
Score: 0.975
Data Source: BioPlex,STRINGDB
IAH1
Tbio
Family: Enzyme
Novelty: 0.13953488
p_int: 0.999957796
p_ni: 0.000042102
p_wrong: 1.02e-7
Score: 0.69
Data Source: BioPlex,STRINGDB
VARS2
Tbio
Family: Enzyme
Novelty: 0.0110026
p_int: 0.999884367
p_ni: 0.000115631
p_wrong: 1e-9
Score: 0.442
Data Source: BioPlex,STRINGDB
UPP1
Tchem
Family: Enzyme
Novelty: 0.01749136
Score: 0.979
Data Source: STRINGDB
UMPS
Tclin
Family: Enzyme
Novelty: 0.00839563
Score: 0.975
Data Source: STRINGDB
CDA
Tchem
Family: Enzyme
Novelty: 0.00243009
Score: 0.955
Data Source: STRINGDB
ENTPD3
Tbio
Family: Enzyme
Novelty: 0.01859181
Score: 0.921
Data Source: STRINGDB
CMPK2
Tbio
Family: Kinase
Novelty: 0.01993395
Score: 0.92
Data Source: STRINGDB
Publication Statistics
PubMed Score  34.35

PubMed score by year
PubTator Score  72.27

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTS
1-70
EQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAF
70-140
YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPR
140-210
GADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
210-261
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH