You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ULBP3
UL16-binding protein 3

Protein Summary
Description
Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity. The protein encoded by this gene is one of several related ligands of the KLRK1/NKG2D receptor, which is found in primary NK cells. Binding of these ligands to the receptor activates several signal transduction pathways, including the JAK2, STAT5, and ERK pathways. The encoded protein is expressed solubly and on the surface of many tumor cells, making it potentially an important target for therapeutics. [provided by RefSeq, Nov 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000367339
  • ENSP00000356308
  • ENSG00000131019
  • ENST00000438272
  • ENSP00000403562

Symbol
  • N2DL3
  • RAET1N
  • N2DL-3
  • RAET1N
  • NKG2DL3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.68
tissue sample
0.56
cell line
0.48
disease
0.47
tissue
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.49   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 127   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.49   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 127   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Protein-Protein Interactions (54)
1 – 10 of 54
ULBP1
Tbio
Novelty: 0.02190147
p_int: 0.999999796
p_ni: 3.1e-8
p_wrong: 1.73e-7
Score: 0.938
Data Source: BioPlex,STRINGDB
SLC39A5
Tbio
Family: Transporter
Novelty: 0.06778122
p_int: 0.99984493
p_ni: 0.000147463
p_wrong: 0.000007608
Data Source: BioPlex
TNFSF8
Tbio
Novelty: 0.01609818
p_int: 0.998803442
p_ni: 0.001196557
p_wrong: 1e-9
Data Source: BioPlex
TMEM30B
Tbio
Novelty: 0.41265163
p_int: 0.99704057
p_ni: 0.002952425
p_wrong: 0.000007006
Data Source: BioPlex
IL27RA
Tbio
Novelty: 0.0146619
p_int: 0.995591319
p_ni: 0.004408615
p_wrong: 6.7e-8
Data Source: BioPlex
HLA-DPA1
Tbio
Novelty: 0.01432663
p_int: 0.994698339
p_ni: 0.005301572
p_wrong: 8.8e-8
Data Source: BioPlex
CEACAM21
Tdark
Novelty: 0.98765432
p_int: 0.994684332
p_ni: 0.005315529
p_wrong: 1.4e-7
Data Source: BioPlex
IL13RA2
Tbio
Novelty: 0.04900852
p_int: 0.994395996
p_ni: 0.005602288
p_wrong: 0.000001717
Score: 0.18
Data Source: BioPlex,STRINGDB
RAET1E
Tbio
Novelty: 0.00641052
p_int: 0.994343666
p_ni: 0.005656327
p_wrong: 7e-9
Score: 0.229
Data Source: BioPlex,STRINGDB
FCGRT
Tchem
Novelty: 0.0014463
p_int: 0.988863522
p_ni: 0.011136476
p_wrong: 2e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  11.49

PubMed score by year
PubTator Score  27.63

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSD
1-70
KVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSW
70-140
QFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTA
140-210
PPTMAPGLAQPKAIATTLSPWSFLIILCFILPGI
210-244
MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAPGLAQPKAIATTLSPWSFLIILCFILPGI