You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TRIM54
Tripartite motif-containing protein 54

Protein Summary
Description
May bind and stabilize microtubules during myotubes formation. The protein encoded by this gene contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296098
  • ENSP00000296098
  • ENSG00000138100
  • ENST00000380075
  • ENSP00000369415

Symbol
  • MURF
  • MURF3
  • RNF30
  • MURF
  • RNF30
  • muRF3
  • MURF-3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.73
disease
0.61
molecular function
0.53
transcription factor
0.5
tissue
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.89   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 318   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.89   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 318   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (43)
1 – 10 of 43
CAVIN4
Tbio
Novelty: 0.03556308
Score: 0.747
Data Source: STRINGDB
BBOX1
Tchem
Family: Enzyme
Novelty: 0.00263045
Score: 0.716
Data Source: STRINGDB
FBXO32
Tbio
Novelty: 0.00277691
Score: 0.706
Data Source: STRINGDB
TTN
Tbio
Family: Kinase
Novelty: 0.00054314
Score: 0.622
Data Source: STRINGDB
FLNC
Tbio
Novelty: 0.00112022
Score: 0.6
Data Source: STRINGDB
NBR1
Tbio
Novelty: 0.0159538
Score: 0.597
Data Source: STRINGDB
CKM
Tbio
Family: Kinase
Novelty: 0.00329483
Score: 0.591
Data Source: STRINGDB
TRIM66
Tdark
Family: Epigenetic
Novelty: 0.39215686
Score: 0.587
Data Source: STRINGDB
TCAP
Tbio
Novelty: 0.00664743
Score: 0.558
Data Source: STRINGDB
ALAD
Tbio
Family: Enzyme
Novelty: 0.00093006
Score: 0.558
Data Source: STRINGDB
Publication Statistics
PubMed Score  37.89

PubMed score by year
PubTator Score  20.97

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNPLWQSRGSTTV
1-70
SSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKAEQHLMCEEHEEEKINIYCLS
70-140
CEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQK
140-210
QLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYL
210-280
QQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGP
280-350
EEERPDGP
350-358
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNPLWQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKAEQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP