You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
KRTAP2-1
Keratin-associated protein 2-1

Protein Summary
Description
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000391419
  • ENSP00000375238
  • ENSG00000212725
  • ENST00000571136
  • ENSP00000458444
  • ENSG00000261852

Symbol
  • KAP2.1
  • KRTAP2.1A
  • KRTAP2.1B
  • KAP2.1A
  • KRTAP2.1A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.39
tissue
0.38
gene perturbation
0.32
cellular component
0.31
microRNA
0.29


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.38   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 9   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.38   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 9   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (79)
1 – 10 of 79
KRTAP3-2
Tdark
Novelty: 5
Score: 0.585
Data Source: STRINGDB
KRTAP24-1
Tdark
Novelty: 0.56074766
Score: 0.577
Data Source: STRINGDB
KRTAP13-3
Tdark
Novelty: 2.5
Score: 0.573
Data Source: STRINGDB
KRTAP11-1
Tdark
Novelty: 0.23575639
Score: 0.569
Data Source: STRINGDB
KRTAP26-1
Tdark
Novelty: 0.63157895
Score: 0.557
Data Source: STRINGDB
KRTAP3-1
Tdark
Score: 0.537
Data Source: STRINGDB
KRTAP9-4
Tdark
Score: 0.505
Data Source: STRINGDB
KRTAP9-3
Tdark
Score: 0.498
Data Source: STRINGDB
KRTAP9-7
Tdark
Score: 0.498
Data Source: STRINGDB
KRTAP9-8
Tdark
Score: 0.494
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.38

PubMed score by year
PubTator Score  0.35

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTGSCCGSTFSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRRPVCCDPCSLQ
1-70
EGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCCRPPCGQPTPCSTTCRTSSC
70-128
MTGSCCGSTFSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRRPVCCDPCSLQEGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCCRPPCGQPTPCSTTCRTSSC