You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
KRTAP9-8
Keratin-associated protein 9-8

Protein Summary
Description
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins. This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the ultrahigh sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq, ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000254072
  • ENSP00000254072
  • ENSG00000187272

Symbol
  • KAP9.8
  • KRTAP9.8
  • KAP9.8
  • KRTAP9.8
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.53
tissue
0.43
microRNA
0.37
transcription factor
0.32
cellular component
0.25


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 1   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 1   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (77)
1 – 10 of 77
KRTAP17-1
Tdark
Novelty: 4
Score: 0.658
Data Source: STRINGDB
KRTAP10-8
Tdark
Score: 0.651
Data Source: STRINGDB
KRTAP10-7
Tdark
Score: 0.65
Data Source: STRINGDB
KRTAP12-3
Tdark
Novelty: 17
Score: 0.588
Data Source: STRINGDB
KRTAP5-11
Tdark
Score: 0.586
Data Source: STRINGDB
KRTAP3-1
Tdark
Score: 0.582
Data Source: STRINGDB
KRTAP26-1
Tdark
Novelty: 0.63157895
Score: 0.552
Data Source: STRINGDB
KRTAP27-1
Tdark
Novelty: 4
Score: 0.536
Data Source: STRINGDB
KRTAP3-3
Tdark
Novelty: 2
Score: 0.531
Data Source: STRINGDB
KRTAP11-1
Tdark
Novelty: 0.23575639
Score: 0.531
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MTHCCSPCCQPTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPTCCQNTCCQPICVTSCCQPSC
1-70
CSTPCCQPTCCGQTSCGSSCGQSSSCAPVYCRRTCYHPTTVCLPGCLNQSCGSNCCQPCCRPACCETTCC
70-140
RTTCFQPTCVSSCCQPSCC
140-159
MTHCCSPCCQPTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPTCCQNTCCQPICVTSCCQPSCCSTPCCQPTCCGQTSCGSSCGQSSSCAPVYCRRTCYHPTTVCLPGCLNQSCGSNCCQPCCRPACCETTCCRTTCFQPTCVSSCCQPSCC