You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
LCE3D
Late cornified envelope protein 3D

Protein Summary
Description
Precursors of the cornified envelope of the stratum corneum.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368787
  • ENSP00000357776
  • ENSG00000163202

Symbol
  • LEP16
  • SPRL6A
  • SPRL6B
  • LEP16
  • SPRL6A
  • SPRL6B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.58
cell line
0.54
tissue
0.45
phenotype
0.37
transcription factor
0.37


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.59   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.59   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Formation of the cornified envelope
Reactome
Keratinization
Name
Explore in Pharos
Explore in Source
Developmental Biology
Formation of the cornified envelope
Keratinization
Gene Ontology Terms (7)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (81)
1 – 10 of 81
SPRR2G
Tdark
Novelty: 2.47272727
Score: 0.98
Data Source: STRINGDB
SPRR2B
Tdark
Novelty: 0.55925433
Score: 0.977
Data Source: STRINGDB
LCE2C
Tdark
Score: 0.977
Data Source: STRINGDB
LCE3A
Tbio
Novelty: 0.45219264
Score: 0.976
Data Source: STRINGDB
LCE2B
Tdark
Novelty: 1.73333333
Score: 0.974
Data Source: STRINGDB
LCE2D
Tdark
Novelty: 3.07692308
Score: 0.974
Data Source: STRINGDB
LCE3E
Tdark
Novelty: 5.38190955
Score: 0.966
Data Source: STRINGDB
SPRR2A
Tbio
Novelty: 0.08509463
Score: 0.962
Data Source: STRINGDB
LCE2A
Tdark
Novelty: 0.66666667
Score: 0.961
Data Source: STRINGDB
IVL
Tbio
Novelty: 0.00154231
Score: 0.96
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.59

PubMed score by year
PubTator Score  2.76

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSCQQNQQQCQPPPKCPSPKCPPKSPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRPNS
1-70
CDRGSGQQGGGSGCGHGSGGCC
70-92
MSCQQNQQQCQPPPKCPSPKCPPKSPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRPNSCDRGSGQQGGGSGCGHGSGGCC