You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IDI2
Isopentenyl-diphosphate delta-isomerase 2

Protein Classes
Protein Summary
Description
Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP). The protein encoded by this gene catalyzes the conversion of isopentenyl diphosphate to dimethylallyl diphosphate, which is a precursor for the synthesis of cholesterol and other isoprenoids. This gene, which is a product of an ancestral gene duplication event, encodes a protein that may be involved in the aggregation of alpha-synuclein in the cerebral cortex of patients with Lewy body disease. In addition, segmental copy number gains in this locus have been associated with sporadic amyotrophic lateral sclerosis. [provided by RefSeq, Jul 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000277517
  • ENSP00000277517
  • ENSG00000148377

Symbol
  • IPPI2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.76
cell line
0.54
tissue sample
0.5
virus perturbation
0.5
pathway
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.65   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 108   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.65   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 108   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
Cholesterol biosynthesis (R-HSA-191273)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cholesterol biosynthesis
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Metabolism of steroids
Name
Explore in Pharos
Explore in Source
Cholesterol biosynthesis
Metabolism
Metabolism of lipids
Metabolism of steroids
Protein-Protein Interactions (59)
1 – 10 of 59
SSBP3
Tbio
Novelty: 0.02698795
p_int: 0.999999884
p_ni: 1.16e-7
Score: 0.86
Data Source: BioPlex,STRINGDB
LDB1
Tbio
Novelty: 0.00548345
p_int: 0.99999943
p_ni: 5.69e-7
Score: 0.832
Data Source: BioPlex,STRINGDB
SSBP2
Tbio
Novelty: 0.07797045
p_int: 0.999998707
p_ni: 0.000001292
p_wrong: 1e-9
Score: 0.867
Data Source: BioPlex,STRINGDB
SSBP4
Tdark
Novelty: 0.54545455
p_int: 0.999997226
p_ni: 0.000002773
p_wrong: 1e-9
Score: 0.873
Data Source: BioPlex,STRINGDB
LMO4
Tbio
Novelty: 0.08518694
p_int: 0.99998866
p_ni: 7.43e-7
p_wrong: 0.000010597
Score: 0.86
Data Source: BioPlex,STRINGDB
FAM76B
Tdark
Novelty: 1
p_int: 0.999848539
p_ni: 0.000151461
Score: 0.345
Data Source: BioPlex,STRINGDB
ISL2
Tbio
Family: TF
Novelty: 0.03469276
p_int: 0.996997367
p_ni: 0.00294532
p_wrong: 0.000057313
Score: 0.867
Data Source: BioPlex,STRINGDB
RABL2B
Tdark
Family: Enzyme
Novelty: 0.23346304
p_int: 0.99531165
p_ni: 0.00459404
p_wrong: 0.00009431
Score: 0.295
Data Source: BioPlex,STRINGDB
RNF114
Tbio
Family: Enzyme
Novelty: 0.07098319
p_int: 0.99531165
p_ni: 0.00459404
p_wrong: 0.00009431
Score: 0.187
Data Source: BioPlex,STRINGDB
LMX1B
Tbio
Family: TF
Novelty: 0.00535467
p_int: 0.851854908
p_ni: 0.007234636
p_wrong: 0.140910457
Score: 0.806
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  23.65

PubMed score by year
PubTator Score  12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFNTKNRILIQQR
1-70
SDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKS
70-140
DRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWELLEREARGEVKVTPWLRTIAERFLYRWWP
140-210
HLDDVTPFVELHKIHRV
210-227
MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFNTKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWELLEREARGEVKVTPWLRTIAERFLYRWWPHLDDVTPFVELHKIHRV