You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ELOVL1
Elongation of very long chain fatty acids protein 1

Protein Summary
Description
Catalyzes the first and rate-limiting reaction of the four that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. Condensing enzyme that exhibits activity toward saturated C18 to C26 acyl-CoA substrates, with the highest activity towards C22:0 acyl-CoA. May participate in the production of both saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Important for saturated C24:0 and monounsaturated C24:1 sphingolipid synthesis. Indirectly inhibits RPE65 via production of VLCFAs.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000372458
  • ENSP00000361536
  • ENSG00000066322
  • ENST00000413844
  • ENSP00000416024
  • ENST00000621943
  • ENSP00000477602

Symbol
  • SSC1
  • Ssc1
  • CGI-88
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
disease perturbation
0.95
transcription factor binding site profile
0.69
histone modification site profile
0.67
transcription factor
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20.27   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 197   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20.27   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 197   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (14)
Fatty acid metabolism (R-HSA-8978868)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Fatty acid metabolism
Reactome
Fatty acyl-CoA biosynthesis
Reactome
Linoleic acid (LA) metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Name
Explore in Pharos
Explore in Source
Fatty acid metabolism
Fatty acyl-CoA biosynthesis
Linoleic acid (LA) metabolism
Metabolism
Metabolism of lipids
Gene Ontology Terms (18)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (56)
1 – 10 of 56
HSD17B12
Tbio
Family: Enzyme
Novelty: 0.03532677
Score: 0.973
Data Source: STRINGDB
SLC27A2
Tbio
Family: Transporter
Novelty: 0.01635728
Score: 0.935
Data Source: STRINGDB
ACSL1
Tbio
Family: Enzyme
Novelty: 0.00272619
Score: 0.927
Data Source: STRINGDB
ACSL3
Tbio
Family: Enzyme
Novelty: 0.02655983
Score: 0.919
Data Source: STRINGDB
ACSL5
Tbio
Family: Enzyme
Novelty: 0.0104023
Score: 0.91
Data Source: STRINGDB
ACSL4
Tbio
Family: Enzyme
Novelty: 0.01090254
Score: 0.907
Data Source: STRINGDB
ACSBG2
Tdark
Family: Enzyme
Novelty: 0.35673769
Score: 0.906
Data Source: STRINGDB
ACSBG1
Tbio
Family: Enzyme
Novelty: 0.00446288
Score: 0.904
Data Source: STRINGDB
CERS2
Tbio
Family: TF
Novelty: 0.01303029
Score: 0.757
Data Source: STRINGDB
SCD
Tchem
Family: Enzyme
Novelty: 0.00078834
Score: 0.668
Data Source: STRINGDB
Publication Statistics
PubMed Score  20.27

PubMed score by year
PubTator Score  36.68

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLV
1-70
ALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFL
70-140
HVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFV
140-210
LVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN
210-279
MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN