You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ALG8
Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase

Protein Summary
Description
Adds the second glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. Transfers glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc(1)Man(9)GlcNAc(2)-PP-Dol before it is transferred to the nascent peptide (By similarity). Required for PKD1/Polycystin-1 maturation and localization to the plasma membrane of the primary cilia (By similarity). This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the second glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation of proteins. Mutations in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ih). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000299626
  • ENSP00000299626
  • ENSG00000159063
  • ENST00000376156
  • ENSP00000365326
  • ENST00000615266
  • ENSP00000480742

Symbol
  • CDG1H
  • PCLD3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.92
kinase perturbation
0.91
transcription factor binding site profile
0.88
disease perturbation
0.68
cell line
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.65   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 106   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.65   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 106   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (13)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Reactome
Defective ALG8 causes ALG8-CDG (CDG-1h)
Reactome
Disease
Reactome
Diseases associated with N-glycosylation of proteins
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Defective ALG8 causes ALG8-CDG (CDG-1h)
Disease
Diseases associated with N-glycosylation of proteins
Gene Ontology Terms (9)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (94)
1 – 10 of 94
HTR3A
Tclin
Family: IC
Novelty: 0.00035394
p_int: 0.996884851
p_ni: 0.003099003
p_wrong: 0.000016146
Data Source: BioPlex
DPEP1
Tclin
Family: Enzyme
Novelty: 0.0033193
p_int: 0.990072408
p_ni: 0.009927592
Data Source: BioPlex
ALG6
Tbio
Family: Enzyme
Novelty: 0.03417142
p_int: 0.986585811
p_ni: 0.013413718
p_wrong: 4.7e-7
Score: 0.983
Data Source: BioPlex,STRINGDB
SCN3B
Tbio
Family: IC
Novelty: 0.08995222
p_int: 0.981234558
p_ni: 0.018761713
p_wrong: 0.000003729
Data Source: BioPlex
CCDC107
Tdark
p_int: 0.969961374
p_ni: 0.027483696
p_wrong: 0.002554929
Data Source: BioPlex
KDELR3
Tdark
Novelty: 0.88948787
p_int: 0.969810618
p_ni: 0.028486406
p_wrong: 0.001702976
Score: 0.154
Data Source: BioPlex,STRINGDB
VIPR2
Tchem
Family: GPCR
Novelty: 0.00602252
p_int: 0.966965193
p_ni: 0.032737308
p_wrong: 0.000297498
Data Source: BioPlex
TSPAN5
Tbio
Novelty: 0.13109854
p_int: 0.96570615
p_ni: 0.034293225
p_wrong: 6.25e-7
Data Source: BioPlex
PBXIP1
Tbio
Novelty: 0.15158351
p_int: 0.963253104
p_ni: 0.036324096
p_wrong: 0.0004228
Data Source: BioPlex
CD79B
Tclin
Novelty: 0.00265318
p_int: 0.960671969
p_ni: 0.036386769
p_wrong: 0.002941262
Data Source: BioPlex
Publication Statistics
PubMed Score  14.65

PubMed score by year
PubTator Score  14.06

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAALTIATGTGNWFSALALGVTLLKCLLIPTYHSTDFEVHRNWLAITHSLPISQWYYEATSEWTLDYPPF
1-70
FAWFEYILSHVAKYFDQEMLNVHNLNYSSSRTLLFQRFSVIFMDVLFVYAVRECCKCIDGKKVGKELTEK
70-140
PKFILSVLLLWNFGLLIVDHIHFQYNGFLFGLMLLSIARLFQKRHMEGAFLFAVLLHFKHIYLYVAPAYG
140-210
VYLLRSYCFTANKPDGSIRWKSFSFVRVISLGLVVFLVSALSLGPFLALNQLPQVFSRLFPFKRGLCHAY
210-280
WAPNFWALYNALDKVLSVIGLKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTPLATLICTLIAILPSIF
280-350
CLWFKPQGPRGFLRCLTLCALSSFMFGWHVHEKAILLAILPMSLLSVGKAGDASIFLILTTTGHYSLFPL
350-420
LFTAPELPIKILLMLLFTIYSISSLKTLFRKEKPLFNWMETFYLLGLGPLEVCCEFVFPFTSWKVKYPFI
420-490
PLLLTSVYCAVGITYAWFKLYVSVLIDSAIGKTKKQ
490-526
MAALTIATGTGNWFSALALGVTLLKCLLIPTYHSTDFEVHRNWLAITHSLPISQWYYEATSEWTLDYPPFFAWFEYILSHVAKYFDQEMLNVHNLNYSSSRTLLFQRFSVIFMDVLFVYAVRECCKCIDGKKVGKELTEKPKFILSVLLLWNFGLLIVDHIHFQYNGFLFGLMLLSIARLFQKRHMEGAFLFAVLLHFKHIYLYVAPAYGVYLLRSYCFTANKPDGSIRWKSFSFVRVISLGLVVFLVSALSLGPFLALNQLPQVFSRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIGLKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTPLATLICTLIAILPSIFCLWFKPQGPRGFLRCLTLCALSSFMFGWHVHEKAILLAILPMSLLSVGKAGDASIFLILTTTGHYSLFPLLFTAPELPIKILLMLLFTIYSISSLKTLFRKEKPLFNWMETFYLLGLGPLEVCCEFVFPFTSWKVKYPFIPLLLTSVYCAVGITYAWFKLYVSVLIDSAIGKTKKQ