You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ADI1
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase

Protein Classes
Protein Summary
Description
Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). Also down-regulates cell migration mediated by MMP14. Necessary for hepatitis C virus replication in an otherwise non-permissive cell line. This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000327435
  • ENSP00000333666
  • ENSG00000182551
  • ENST00000382093
  • ENSP00000371525

Symbol
  • MTCBP1
  • ARD
  • APL1
  • SIPL
  • mtnD
  • Fe-ARD
  • MTCBP1
  • Ni-ARD
  • HMFT1638
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
histone modification site profile
0.86
kinase perturbation
0.71
tissue
0.71
tissue sample
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 112.92   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 277   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 112.92   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 277   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (10)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Reactome
Methionine salvage pathway
Reactome
Sulfur amino acid metabolism
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of amino acids and derivatives
Methionine salvage pathway
Sulfur amino acid metabolism
Protein-Protein Interactions (61)
1 – 10 of 61
ENOPH1
Tbio
Family: Enzyme
Novelty: 0.10518475
Score: 0.996
Data Source: STRINGDB
APIP
Tbio
Family: Enzyme
Novelty: 0.12194478
Score: 0.959
Data Source: STRINGDB
MRI1
Tbio
Family: Enzyme
Novelty: 0.00421775
Score: 0.944
Data Source: STRINGDB
TAT
Tbio
Family: Enzyme
Novelty: 0.00082991
Score: 0.921
Data Source: STRINGDB
IL4I1
Tbio
Family: Enzyme
Novelty: 0.00147724
Score: 0.908
Data Source: STRINGDB
PGM3
Tbio
Family: Enzyme
Novelty: 0.00597595
Score: 0.708
Data Source: STRINGDB
MMP14
Tchem
Family: Enzyme
Novelty: 0.00092685
Score: 0.688
Data Source: STRINGDB
KLHDC3
Tdark
Novelty: 0.27149321
Score: 0.686
Data Source: STRINGDB
DGCR2
Tbio
Novelty: 0.07054328
Score: 0.654
Data Source: STRINGDB
SMS
Tchem
Family: Enzyme
Novelty: 0.03313893
Score: 0.62
Data Source: STRINGDB
Publication Statistics
PubMed Score  112.92

PubMed score by year
PubTator Score  181.71

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITIC
1-70
KDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEK
70-140
NYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
140-179
MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA