You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SPON2
Spondin-2

Protein Summary
Description
Cell adhesion protein that promotes adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. Essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens (By similarity). Binds bacterial lipopolysaccharide (LPS).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000290902
  • ENSP00000290902
  • ENSG00000159674
  • ENST00000431380
  • ENSP00000394832
  • ENST00000617421
  • ENSP00000483599

Symbol
  • DIL1
  • DIL1
  • DIL-1
  • MINDIN
  • M-SPONDIN
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
small molecule perturbation
0.76
tissue sample
0.68
cell type or tissue
0.67
biological process
0.6
gene perturbation
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 64.13   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 284   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 64.13   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 284   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Defective B3GALTL causes Peters-plus syndrome (PpS) (R-HSA-5083635)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Defective B3GALTL causes Peters-plus syndrome (PpS)
Reactome
Disease
Reactome
Diseases associated with O-glycosylation of proteins
Reactome
Diseases of glycosylation
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Defective B3GALTL causes Peters-plus syndrome (PpS)
Disease
Diseases associated with O-glycosylation of proteins
Diseases of glycosylation
Metabolism of proteins
Gene Ontology Terms (17)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (64)
1 – 10 of 64
THBS2
Tbio
Novelty: 0.00401454
Score: 0.921
Data Source: STRINGDB
THSD1
Tbio
Novelty: 0.14679078
Score: 0.92
Data Source: STRINGDB
CFP
Tbio
Novelty: 0.00062861
Score: 0.919
Data Source: STRINGDB
THBS1
Tbio
Novelty: 0.00083403
Score: 0.914
Data Source: STRINGDB
SPON1
Tbio
Novelty: 0.00388947
Score: 0.912
Data Source: STRINGDB
ITGB2
Tclin
Novelty: 0.00237551
Score: 0.912
Data Source: STRINGDB
ADAMTSL4
Tbio
Novelty: 0.04959452
Score: 0.91
Data Source: STRINGDB
ADAMTS9
Tbio
Family: Enzyme
Novelty: 0.02029894
Score: 0.908
Data Source: STRINGDB
ADAMTS5
Tchem
Family: Enzyme
Novelty: 0.00480382
Score: 0.907
Data Source: STRINGDB
THSD4
Tbio
Novelty: 0.16828393
Score: 0.907
Data Source: STRINGDB
Publication Statistics
PubMed Score  64.13

PubMed score by year
PubTator Score  28.68

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MENPSPAAALGKALCALLLATLGAAGQPLGGESICSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWS
1-70
SLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAEL
70-140
EVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTV
140-210
TEITSSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEV
210-280
SLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV
280-331
MENPSPAAALGKALCALLLATLGAAGQPLGGESICSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV