You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MKNK1
MAP kinase-interacting serine/threonine-protein kinase 1

Protein Classes
Protein Summary
Description
May play a role in the response to environmental stress and cytokines. Appears to regulate translation by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap. This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription by phosphorylating eIF4E via interaction with the C-terminal region of eIF4G. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371945
  • ENSP00000361013
  • ENSG00000079277
  • ENST00000371946
  • ENSP00000361014
  • ENST00000428112
  • ENSP00000411135

Symbol
  • MNK1
  • MNK1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.97
molecular function
0.96
virus perturbation
0.88
disease perturbation
0.83
protein domain
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 55.33   (req: < 5)
Gene RIFs: 46   (req: <= 3)
Antibodies: 505   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 55.33   (req: >= 5)
Gene RIFs: 46   (req: > 3)
Antibodies: 505   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 47
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (179)
Negative regulation of FGFR1 signaling (R-HSA-5654726)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Negative regulation of FGFR1 signaling
Reactome
Negative regulation of FGFR2 signaling
Reactome
Negative regulation of FGFR3 signaling
Reactome
Negative regulation of FGFR4 signaling
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Negative regulation of FGFR1 signaling
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
Signal Transduction
Gene Ontology Terms (13)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (39)
1 – 10 of 39
MAPK14
Tchem
Family: Kinase
Novelty: 0.00018655
p_int: 1
Score: 0.981
Data Source: BioPlex,STRINGDB
EIF4E
Tchem
Novelty: 0.00088513
Score: 0.995
Data Source: STRINGDB
EIF4G1
Tbio
Novelty: 0.00219215
Score: 0.986
Data Source: STRINGDB
EIF4A1
Tchem
Novelty: 0.0043238
Score: 0.963
Data Source: STRINGDB
MAPK1
Tchem
Family: Kinase
Novelty: 0.00046573
Score: 0.957
Data Source: STRINGDB
MAPK11
Tchem
Family: Kinase
Novelty: 0.00860226
Score: 0.955
Data Source: STRINGDB
MAPK3
Tchem
Family: Kinase
Novelty: 0.0001911
Score: 0.954
Data Source: STRINGDB
PLA2G4A
Tchem
Family: Enzyme
Novelty: 0.00209984
Score: 0.951
Data Source: STRINGDB
SPRY2
Tbio
Novelty: 0.01058901
Score: 0.941
Data Source: Reactome,STRINGDB
PPP2CA
Tchem
Family: Enzyme
Novelty: 0.00655436
Score: 0.938
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  55.33

PubMed score by year
PubTator Score  72.07

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQ
1-70
NGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQK
70-140
HFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHR
140-210
DLKPENILCESPEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDK
210-280
RCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDL
280-350
ISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
350-420
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL
420-465
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL