You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DOHH
Deoxyhypusine hydroxylase

Protein Summary
Description
Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate produced by deoxyhypusine synthase/DHPS on a critical lysine of the eukaryotic translation initiation factor 5A/eIF-5A. This is the second step of the post-translational modification of that lysine into an unusual amino acid residue named hypusine (PubMed:16533814, PubMed:16371467, PubMed:19706422). Hypusination is unique to mature eIF-5A factor and is essential for its function (By similarity). This gene encodes a metalloenzyme that catalyzes the last step in the conversion of lysine to the unique amino acid hypusine in eukaryotic initiation factor 5A. The encoded protein hydroxylates deoxyhypusine to form hypusine in the mature eukaryotic initiation factor 5A protein. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000427575
  • ENSP00000398882
  • ENSG00000129932

Symbol
  • HLRC1
  • HLRC1
  • hDOHH
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.81
disease perturbation
0.74
protein domain
0.73
tissue sample
0.68
transcription factor
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.47   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 41   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.47   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 41   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Gamma carboxylation, hypusine formation and arylsulfatase activation (R-HSA-163841)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gamma carboxylation, hypusine formation and arylsulfatase activation
Reactome
Hypusine synthesis from eIF5A-lysine
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Gamma carboxylation, hypusine formation and arylsulfatase activation
Hypusine synthesis from eIF5A-lysine
Metabolism of proteins
Post-translational protein modification
Protein-Protein Interactions (176)
1 – 10 of 176
EIF5A2
Tbio
Novelty: 0.01838689
p_int: 0.999999495
p_ni: 5.05e-7
Score: 0.993
Data Source: BioPlex,Reactome,STRINGDB
EIF5A
Tbio
Novelty: 0.00743231
p_int: 0.991869577
p_ni: 0.008130423
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
IDE
Tchem
Family: Enzyme
Novelty: 0.00249504
p_int: 0.917420744
p_ni: 0.082579256
Score: 0.62
Data Source: BioPlex,STRINGDB
C14orf119
Tdark
p_int: 0.912426166
p_ni: 0.087505851
p_wrong: 0.000067983
Data Source: BioPlex
FN3KRP
Tbio
Family: Kinase
Novelty: 0.13370228
p_int: 0.897311622
p_ni: 0.102688378
Score: 0.288
Data Source: BioPlex,STRINGDB
STARD7
Tbio
Novelty: 0.05559625
p_int: 0.866965911
p_ni: 0.133034088
p_wrong: 1e-9
Score: 0.187
Data Source: BioPlex,STRINGDB
SCNM1
Tdark
Novelty: 0.24120603
p_int: 0.833389895
p_ni: 0.166607223
p_wrong: 0.000002882
Score: 0.214
Data Source: BioPlex,STRINGDB
DHPS
Tbio
Family: Enzyme
Novelty: 0.01069486
Score: 0.997
Data Source: STRINGDB
ALKBH4
Tdark
Family: Enzyme
Novelty: 0.24842049
Score: 0.913
Data Source: STRINGDB
NOB1
Tbio
Novelty: 0.01469497
Score: 0.908
Data Source: STRINGDB
Publication Statistics
PubMed Score  23.47

PubMed score by year
PubTator Score  28.63

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARA
1-70
IPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPA
70-140
AGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVG
140-210
YVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMY
210-280
EHETGRAFQYADGLEQLRGAPS
280-302
MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPAAGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVGYVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMYEHETGRAFQYADGLEQLRGAPS