You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
H2AFJ
Histone H2A.J

Protein Summary
Description
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is located on chromosome 12 and encodes a replication-independent histone that is a variant H2A ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000389078
  • ENSP00000373730
  • ENSG00000246705
  • ENST00000544848
  • ENSP00000438553

Symbol
  • H2AJ
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.84
cellular component
0.78
cell type or tissue
0.75
small molecule perturbation
0.74
gene perturbation
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.55   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 124   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.55   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 124   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (80)
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 (R-HSA-5625886)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 71
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
Reactome
Activation of HOX genes during differentiation
Reactome
Activation of anterior HOX genes in hindbrain development during early embryogenesis
Reactome
B-WICH complex positively regulates rRNA expression
Reactome
Base Excision Repair
Name
Explore in Pharos
Explore in Source
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
Activation of HOX genes during differentiation
Activation of anterior HOX genes in hindbrain development during early embryogenesis
B-WICH complex positively regulates rRNA expression
Base Excision Repair
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (360)
1 – 10 of 360
HIST1H2BB
Tbio
Novelty: 0.87484449
Score: 0.997
Data Source: STRINGDB
HIST2H2AC
Tbio
Novelty: 0.00121358
Score: 0.995
Data Source: STRINGDB
HIST1H2AC
Tdark
Novelty: 0.72413793
Score: 0.995
Data Source: STRINGDB
HIST1H2AH
Tbio
Novelty: 0.12912075
Score: 0.994
Data Source: STRINGDB
HIST1H2AJ
Tdark
Novelty: 1.19266055
Score: 0.994
Data Source: STRINGDB
HIST1H2BN
Tbio
Novelty: 0.03305525
Score: 0.988
Data Source: STRINGDB
HIST2H2BE
Tbio
Novelty: 0.00035412
Score: 0.984
Data Source: STRINGDB
HIST1H2AA
Tbio
Novelty: 0.16667769
Score: 0.979
Data Source: STRINGDB
HIST3H3
Tbio
Novelty: 0.09996887
Score: 0.976
Data Source: STRINGDB
KDM1A
Tchem
Family: Epigenetic
Novelty: 0.00170368
Score: 0.972
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.55

PubMed score by year
PubTator Score  8.88

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA
1-70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK
70-129
MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK