You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ANAPC13
Anaphase-promoting complex subunit 13

Protein Summary
Description
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. This gene encodes a component of the anaphase promoting complex, a large ubiquitin-protein ligase that controls cell cycle progression by regulating the degradation of cell cycle regulators such as B-type cyclins. The encoded protein is evolutionarily conserved and is required for the integrity and ubiquitin ligase activity of the anaphase promoting complex. Pseudogenes and splice variants have been found for this gene; however, the biological validity of some of the splice variants has not been determined. [provided by RefSeq, Nov 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000354910
  • ENSP00000346987
  • ENSG00000129055
  • ENST00000510994
  • ENSP00000421842
  • ENST00000511751
  • ENSP00000421760
  • ENST00000514612
  • ENSP00000427327

Symbol
  • SWM1
  • APC13
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.9
histone modification site profile
0.85
kinase perturbation
0.84
transcription factor binding site profile
0.81
microRNA
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.45   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 69   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.45   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 69   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen processing: Ubiquitination & Proteasome degradation
Reactome
Class I MHC mediated antigen processing & presentation
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen processing: Ubiquitination & Proteasome degradation
Class I MHC mediated antigen processing & presentation
Immune System
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (319)
1 – 10 of 319
ANAPC4
Tbio
Family: Enzyme
Novelty: 1.93548387
p_int: 0.999999929
p_ni: 7.1e-8
Score: 0.999
Data Source: BioPlex,STRINGDB
CDC16
Tbio
Novelty: 0.01336597
p_int: 0.999999852
p_ni: 1.45e-7
p_wrong: 3e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC2
Tbio
Family: Enzyme
Novelty: 0.25398893
p_int: 0.999999829
p_ni: 1.71e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
CDC26
Tbio
Family: Enzyme
Novelty: 0.12631579
p_int: 0.999999684
p_ni: 3.16e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
CDC27
Tbio
Novelty: 0.00956925
p_int: 0.999998604
p_ni: 0.000001395
Score: 0.999
Data Source: BioPlex,STRINGDB
CDC23
Tbio
Novelty: 0.02675154
p_int: 0.999998592
p_ni: 0.000001407
p_wrong: 1e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC5
Tbio
Family: Enzyme
Novelty: 0.0345899
p_int: 0.999994955
p_ni: 0.000005045
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC1
Tbio
Family: Enzyme
Novelty: 0.02248926
p_int: 0.999992953
p_ni: 0.000007047
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC7
Tbio
Family: Enzyme
Novelty: 0.39914469
p_int: 0.999780961
p_ni: 0.000219039
Score: 0.999
Data Source: BioPlex,STRINGDB
FZR1
Tbio
Novelty: 0.01409033
p_int: 0.999670686
p_ni: 0.000329314
Score: 0.995
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  8.45

PubMed score by year
PubTator Score  5.59

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVP
1-70
PIGN
70-74
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN