You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PYGO2
Pygopus homolog 2

Protein Summary
Description
Involved in signal transduction through the Wnt pathway.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368457
  • ENSP00000357442
  • ENSG00000163348

Symbol
  • 1190004M21Rik
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.83
protein domain
0.73
transcription factor binding site profile
0.69
histone modification site profile
0.67
tissue sample
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 27.6   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 137   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 27.6   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 137   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (12)
Deactivation of the beta-catenin transactivating complex (R-HSA-3769402)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Deactivation of the beta-catenin transactivating complex
Reactome
Formation of the beta-catenin:TCF transactivating complex
Reactome
Signal Transduction
Reactome
Signaling by WNT
Reactome
TCF dependent signaling in response to WNT
Name
Explore in Pharos
Explore in Source
Deactivation of the beta-catenin transactivating complex
Formation of the beta-catenin:TCF transactivating complex
Signal Transduction
Signaling by WNT
TCF dependent signaling in response to WNT
Protein-Protein Interactions (58)
1 – 10 of 58
BCL9
Tbio
Novelty: 0.02276827
Score: 0.986
Data Source: Reactome,STRINGDB
CTNNB1
Tchem
Novelty: 0.00008951
Score: 0.976
Data Source: Reactome,STRINGDB
LEF1
Tchem
Family: TF
Novelty: 0.00223818
Score: 0.961
Data Source: Reactome,STRINGDB
BCL9L
Tbio
Novelty: 0.08549112
Score: 0.956
Data Source: Reactome,STRINGDB
KMT2D
Tbio
Family: Epigenetic
Novelty: 0.00631634
Score: 0.948
Data Source: STRINGDB
LDB1
Tbio
Novelty: 0.00548345
Score: 0.935
Data Source: STRINGDB
ASH2L
Tbio
Family: Enzyme
Novelty: 0.02441135
Score: 0.935
Data Source: STRINGDB
RBBP5
Tbio
Novelty: 0.0339304
Score: 0.932
Data Source: STRINGDB
CTBP1
Tbio
Novelty: 0.00313629
Score: 0.928
Data Source: STRINGDB
TCF7
Tbio
Family: TF
Novelty: 0.0150836
Score: 0.926
Data Source: STRINGDB
Publication Statistics
PubMed Score  27.60

PubMed score by year
PubTator Score  29.82

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAASAPPPPDKLEGGGGPAPPPAPPSTGRKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVD
1-70
HLVASNPFEDDFGAPKVGVAAPPFLGSPVPFGGFRVQGGMAGQVPPGYSTGGGGGPQPLRRQPPPFPPNP
70-140
MGPAFNMPPQGPGYPPPGNMNFPSQPFNQPLGQNFSPPSGQMMPGPVGGFGPMISPTMGQPPRAELGPPS
140-210
LSQRFAQPGAPFGPSPLQRPGQGLPSLPPNTSPFPGPDPGFPGPGGEDGGKPLNPPASTAFPQEPHSGSP
210-280
AAAVNGNQPSFPPNSSGRGGGTPDANSLAPPGKAGGGSGPQPPPGLVYPCGACRSEVNDDQDAILCEASC
280-350
QKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEIQSVYIREGMGQLVAANDG
350-406
MAASAPPPPDKLEGGGGPAPPPAPPSTGRKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVDHLVASNPFEDDFGAPKVGVAAPPFLGSPVPFGGFRVQGGMAGQVPPGYSTGGGGGPQPLRRQPPPFPPNPMGPAFNMPPQGPGYPPPGNMNFPSQPFNQPLGQNFSPPSGQMMPGPVGGFGPMISPTMGQPPRAELGPPSLSQRFAQPGAPFGPSPLQRPGQGLPSLPPNTSPFPGPDPGFPGPGGEDGGKPLNPPASTAFPQEPHSGSPAAAVNGNQPSFPPNSSGRGGGTPDANSLAPPGKAGGGSGPQPPPGLVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEIQSVYIREGMGQLVAANDG