You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC25A21
Mitochondrial 2-oxodicarboxylate carrier

Protein Summary
Description
Transports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2-oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate. SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.[supplied by OMIM, Apr 2004]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000331299
  • ENSP00000329452
  • ENSG00000183032
  • ENST00000555449
  • ENSP00000451873

Symbol
  • ODC
  • ODC
  • ODC1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.82
transcription factor
0.75
cell type or tissue
0.74
transcription factor binding site profile
0.7
phenotype
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.96   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 146   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.96   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 146   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Lysine catabolism (R-HSA-71064)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Lysine catabolism
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Name
Explore in Pharos
Explore in Source
Lysine catabolism
Metabolism
Metabolism of amino acids and derivatives
Protein-Protein Interactions (57)
1 – 10 of 57
TBX20
Tbio
Family: TF
Novelty: 0.01591161
p_int: 0.999989585
p_ni: 0.000010384
p_wrong: 3.1e-8
Score: 0.859
Data Source: BioPlex,STRINGDB
DNASE1L2
Tbio
Family: Enzyme
Novelty: 0.02115905
p_int: 0.978605273
p_ni: 0.021393925
p_wrong: 8.02e-7
Score: 0.822
Data Source: BioPlex,STRINGDB
PPIE
Tbio
Family: Enzyme
Novelty: 0.03882478
p_int: 0.964032939
p_ni: 0.035967061
Score: 0.161
Data Source: BioPlex,STRINGDB
OGDH
Tbio
Family: Enzyme
Novelty: 0.01059143
Score: 0.756
Data Source: STRINGDB
MIPOL1
Tbio
Novelty: 0.52272981
Score: 0.749
Data Source: STRINGDB
SLC39A11
Tbio
Family: Transporter
Novelty: 0.17170679
Score: 0.702
Data Source: STRINGDB
PAX9
Tbio
Family: TF
Novelty: 0.00768556
Score: 0.684
Data Source: STRINGDB
CERS6
Tbio
Family: TF
Novelty: 0.02693521
Score: 0.673
Data Source: STRINGDB
ARHGAP1
Tbio
Family: Enzyme
Novelty: 0.00781203
Score: 0.643
Data Source: STRINGDB
CFAP57
Tdark
Novelty: 1.33333333
Score: 0.591
Data Source: STRINGDB
Publication Statistics
PubMed Score  4.96

PubMed score by year
PubTator Score  5.34

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLF
1-70
GFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQAN
70-140
RNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRK
140-210
FGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPG
210-280
GAVMLLVYEYTYSWLQENW
280-299
MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW