You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SYT3
Synaptotagmin-3

Protein Summary
Description
Ca(2+) sensor involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain. Ca(2+) induces binding of the C2-domains to phospholipid membranes and to assembled SNARE-complexes; both actions contribute to triggering exocytosis (By similarity). Plays a role in dendrite formation by melanocytes (PubMed:23999003).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000338916
  • ENSP00000340914
  • ENSG00000213023
  • ENST00000593901
  • ENSP00000468982
  • ENST00000600079
  • ENSP00000469398

Symbol
  • SytIII
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.76
cell type or tissue
0.65
molecular function
0.63
tissue sample
0.58
tissue
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.97   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 188   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.97   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 188   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (18)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (92)
1 – 10 of 92
SYT6
Tbio
Novelty: 0.06825054
p_int: 0.999999999
p_ni: 1e-9
Score: 0.86
Data Source: BioPlex,STRINGDB
SYT10
Tbio
Novelty: 0.07565117
p_int: 0.999999821
p_ni: 1e-9
p_wrong: 1.79e-7
Score: 0.857
Data Source: BioPlex,STRINGDB
MYH4
Tbio
Novelty: 0.00797522
p_int: 0.999570661
p_ni: 0.000429338
p_wrong: 2e-9
Score: 0.188
Data Source: BioPlex,STRINGDB
FNDC3A
Tbio
Novelty: 0.00427151
p_int: 0.999160495
p_ni: 0.000839041
p_wrong: 4.64e-7
Score: 0.169
Data Source: BioPlex,STRINGDB
MYH7
Tbio
Novelty: 0.00255398
p_int: 0.996462723
p_ni: 0.00337035
p_wrong: 0.000166926
Score: 0.187
Data Source: BioPlex,STRINGDB
MADD
Tbio
Family: Enzyme
Novelty: 0.01721987
p_int: 0.971027641
p_ni: 0.028972358
p_wrong: 1e-9
Score: 0.8
Data Source: BioPlex,STRINGDB
PGK2
Tbio
Family: Kinase
Novelty: 0.01008054
p_int: 0.961901175
p_ni: 0.03809881
p_wrong: 1.5e-8
Score: 0.177
Data Source: BioPlex,STRINGDB
LMF2
Tdark
Family: Enzyme
Novelty: 0.34285714
p_int: 0.76747387
p_ni: 0.232396314
p_wrong: 0.000129816
Score: 0.166
Data Source: BioPlex,STRINGDB
SNAP25
Tclin
Novelty: 0.0020914
Score: 0.881
Data Source: STRINGDB
CPLX1
Tbio
Novelty: 0.01111396
Score: 0.738
Data Source: STRINGDB
Publication Statistics
PubMed Score  24.97

PubMed score by year
PubTator Score  9.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNDRIRGYPRGPDADISVSLLSVIVTFCGIVLLGV
1-70
SLFVSWKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGGHPLLGGPHHHAHAAHHP
70-140
PFAELLEPGSLGGSDTPEPSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPS
140-210
AQSHQQVTSLAPTTRYPALPRPLTQQTLTSQPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGP
210-280
GGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKK
280-350
FQTKVHRKTLNPVFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWR
350-420
DIVEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIK
420-490
KNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKP
490-560
VEHWHQLVEEKTVTSFTKGSKGLSEKENSE
560-590
MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNDRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGGHPLLGGPHHHAHAAHHPPFAELLEPGSLGGSDTPEPSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTSQPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPVFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDIVEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKPVEHWHQLVEEKTVTSFTKGSKGLSEKENSE