You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RARRES2
Retinoic acid receptor responder protein 2

Protein Summary
Description
Adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2). Positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. Also acts as a proinflammatory adipokine, causing an increase in secretion of proinflammatory and prodiabetic adipokines, which further impair adipose tissue metabolic function and have negative systemic effects including impaired insulin sensitivity, altered glucose and lipid metabolism, and a decrease in vascular function in other tissues. Can have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. Acts as a chemotactic facto ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000223271
  • ENSP00000223271
  • ENSG00000106538
  • ENST00000466675
  • ENSP00000418009
  • ENST00000482669
  • ENSP00000418483

Symbol
  • TIG2
  • TIG2
  • HP10433
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.9
biological term
0.8
biological process
0.77
small molecule perturbation
0.72
gene perturbation
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 377.63   (req: < 5)
Gene RIFs: 153   (req: <= 3)
Antibodies: 329   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 377.63   (req: >= 5)
Gene RIFs: 153   (req: > 3)
Antibodies: 329   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Hemostasis (R-HSA-109582)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Hemostasis
Reactome
Platelet activation, signaling and aggregation
Reactome
Platelet degranulation
Reactome
Response to elevated platelet cytosolic Ca2+
Name
Explore in Pharos
Explore in Source
Hemostasis
Platelet activation, signaling and aggregation
Platelet degranulation
Response to elevated platelet cytosolic Ca2+
Gene Ontology Terms (23)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (71)
1 – 10 of 71
TNFSF9
Tbio
Novelty: 0.00636223
p_int: 0.995290188
p_ni: 0.004709746
p_wrong: 6.6e-8
Data Source: BioPlex
TUBB8
Tclin
Novelty: 0.11569363
p_int: 0.972931668
p_ni: 0.027068332
Data Source: BioPlex
HLA-DPB1
Tbio
Novelty: 0.0020815
p_int: 0.875848957
p_ni: 0.124151032
p_wrong: 1.1e-8
Data Source: BioPlex
CDKN2D
Tbio
Family: Enzyme
Novelty: 0.02077911
p_int: 0.858957787
p_ni: 0.14104221
p_wrong: 4e-9
Data Source: BioPlex
CMKLR1
Tchem
Family: GPCR
Novelty: 0.00748603
Score: 0.951
Data Source: STRINGDB
ITIH3
Tbio
Novelty: 0.05958095
Score: 0.908
Data Source: STRINGDB
SELENOP
Tbio
Novelty: 0.00258768
Score: 0.908
Data Source: STRINGDB
TIMP3
Tbio
Family: Enzyme
Novelty: 0.00167301
Score: 0.908
Data Source: STRINGDB
SERPINA4
Tbio
Novelty: 0.00102012
Score: 0.905
Data Source: STRINGDB
CLEC3B
Tbio
Novelty: 0.00183004
Score: 0.904
Data Source: STRINGDB
Publication Statistics
PubMed Score  377.63

PubMed score by year
PubTator Score  289.82

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF
1-70
KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR
70-140
AGEDPHSFYFPGQFAFSKALPRS
140-163
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS