You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SH3GL1
Endophilin-A2

Protein Summary
Description
Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity). This gene encodes a member of the endophilin family of Src homology 3 domain-containing proteins. The encoded protein is involved in endocytosis and may also play a role in the cell cycle. Overexpression of this gene may play a role in leukemogenesis, and the encoded protein has been implicated in acute myeloid leukemia as a fusion partner of the myeloid-lymphoid leukemia protein. Pseudogenes of this gene are located on the long arm of chromosomes 11 and 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000269886
  • ENSP00000269886
  • ENSG00000141985
  • ENST00000417295
  • ENSP00000404568
  • ENST00000598564
  • ENSP00000470792

Symbol
  • CNSA1
  • SH3D2B
  • EEN
  • CNSA1
  • SH3P8
  • SH3D2B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.9
disease perturbation
0.83
transcription factor
0.74
kinase perturbation
0.71
tissue sample
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 100.53   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 342   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 100.53   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 342   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (19)
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 14
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cargo recognition for clathrin-mediated endocytosis
Reactome
Clathrin-mediated endocytosis
Reactome
Disease
Reactome
EGFR downregulation
Reactome
Infectious disease
Name
Explore in Pharos
Explore in Source
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Disease
EGFR downregulation
Infectious disease
Gene Ontology Terms (25)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (214)
1 – 10 of 214
SH3GL2
Tbio
Novelty: 0.01452567
p_int: 0.999999981
p_ni: 1.9e-8
Score: 0.985
Data Source: BioPlex,STRINGDB
SH3GL3
Tbio
Novelty: 0.08024683
p_int: 0.999999324
p_ni: 6.76e-7
Score: 0.985
Data Source: BioPlex,STRINGDB
ARHGAP8
Tbio
Family: Enzyme
Novelty: 0.33816845
p_int: 0.99999648
p_ni: 0.00000352
Score: 0.593
Data Source: BioPlex,STRINGDB
AURKA
Tchem
Family: Kinase
Novelty: 0.00069833
p_int: 0.999445404
p_ni: 0.000554596
Score: 0.22
Data Source: BioPlex,STRINGDB
AZU1
Tbio
Family: Enzyme
Novelty: 0.00308218
p_int: 0.999152966
p_ni: 0.000847034
Score: 0.588
Data Source: BioPlex,STRINGDB
DPPA4
Tbio
Novelty: 0.09606623
p_int: 0.998628616
p_ni: 0.001371384
Score: 0.338
Data Source: BioPlex,STRINGDB
TPTE2
Tbio
Family: Enzyme
Novelty: 0.04938272
p_int: 0.984309031
p_ni: 0.015690969
Score: 0.153
Data Source: BioPlex,STRINGDB
SGF29
Tbio
Family: Epigenetic
Novelty: 0.00156606
p_int: 0.980773529
p_ni: 0.019226471
Data Source: BioPlex
C8G
Tbio
Novelty: 0.02481402
p_int: 0.973885829
p_ni: 0.026114133
p_wrong: 3.8e-8
Score: 0.232
Data Source: BioPlex,STRINGDB
GPX7
Tbio
Family: Enzyme
Novelty: 0.02063033
p_int: 0.937358782
p_ni: 0.062641218
Score: 0.151
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  100.53

PubMed score by year
PubTator Score  26.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTM
1-70
LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFI
70-140
DPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIE
140-210
QVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTA
210-280
PKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDG
280-350
QSGFFPLSYVEVLVPLPQ
350-368
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ