You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RNF5
E3 ubiquitin-protein ligase RNF5

Protein Summary
Description
Has E2-dependent E3 ubiquitin-protein ligase activity. May function together with E2 ubiquitin-conjugating enzymes UBE2D1/UBCH5A and UBE2D2/UBC4. Mediates ubiquitination of PXN/paxillin and Salmonella type III secreted protein sopA. May be involved in regulation of cell motility and localization of PXN/paxillin. Mediates the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD; the ubiquitination appears to involve E2 ubiquitin-conjugating enzyme UBE2N. Mediates the 'Lys-48'-linked polyubiquitination of TMEM173 at 'Lys-150' leading to its proteasomal degradation; the ubiquitination occurs in mitochondria after viral transfection and regulates antiviral responses. The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000375094
  • ENSP00000364235
  • ENSG00000204308
  • ENST00000413786
  • ENSP00000387879
  • ENSG00000225452
  • ENST00000432616
  • ENSP00000413131
  • ENSG00000183574
  • ENST00000445885
  • ENSP00000401172
  • ENSG00000227277
  • ENST00000449794
  • ENSP00000415784
  • ENSG00000223767
  • ENST00000453473
  • ENSP00000415127
  • ENSG00000228907
  • ENST00000456167
  • ENSP00000388795
  • ENSG00000228405

Symbol
  • G16
  • NG2
  • RMA1
  • RMA1
  • RING5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.95
virus perturbation
0.85
cellular component
0.76
biological process
0.62
trait
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.6   (req: < 5)
Gene RIFs: 17   (req: <= 3)
Antibodies: 215   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.6   (req: >= 5)
Gene RIFs: 17   (req: > 3)
Antibodies: 215   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (14)
ABC transporter disorders (R-HSA-5619084)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ABC transporter disorders
Reactome
ABC-family proteins mediated transport
Reactome
Asparagine N-linked glycosylation
Reactome
Calnexin/calreticulin cycle
Reactome
Defective CFTR causes cystic fibrosis
Name
Explore in Pharos
Explore in Source
ABC transporter disorders
ABC-family proteins mediated transport
Asparagine N-linked glycosylation
Calnexin/calreticulin cycle
Defective CFTR causes cystic fibrosis
Gene Ontology Terms (24)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (116)
1 – 10 of 116
RHBDD1
Tbio
Family: Enzyme
Novelty: 0.09204807
p_int: 0.995495641
p_ni: 0.004496993
p_wrong: 0.000007365
Score: 0.185
Data Source: BioPlex,STRINGDB
GOLM1
Tbio
Novelty: 0.0087997
p_int: 0.97784602
p_ni: 0.02215387
p_wrong: 1.1e-7
Data Source: BioPlex
ST7L
Tbio
Novelty: 0.03112044
p_int: 0.973555047
p_ni: 0.026310445
p_wrong: 0.000134508
Data Source: BioPlex
PCNX3
Tdark
Novelty: 1.89473684
p_int: 0.847760842
p_ni: 0.151310194
p_wrong: 0.000928964
Data Source: BioPlex
CYHR1
Tdark
Novelty: 0.02215891
p_int: 0.803273726
p_ni: 0.000034394
p_wrong: 0.19669188
Data Source: BioPlex
TMEM259
Tbio
Novelty: 0.04707896
p_int: 0.800195233
p_ni: 0.199804767
Score: 0.188
Data Source: BioPlex,STRINGDB
DERL1
Tbio
Novelty: 0.0156695
Score: 0.982
Data Source: STRINGDB
SEL1L
Tbio
Novelty: 0.01113296
Score: 0.977
Data Source: STRINGDB
CFTR
Tclin
Family: IC
Novelty: 0.00015058
Score: 0.97
Data Source: STRINGDB
DERL2
Tbio
Novelty: 0.02848448
Score: 0.959
Data Source: STRINGDB
Publication Statistics
PubMed Score  19.60

PubMed score by year
PubTator Score  27.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAG
1-70
ISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNA
70-140
HEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
140-180
MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI