You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FOXB1
Forkhead box protein B1

IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.84   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 137   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.84   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 137   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 23
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (44)
1 – 10 of 44
OTP
Tbio
Family: TF
Novelty: 0.00597958
Score: 0.689
Data Source: STRINGDB
EVX1
Tbio
Family: TF
Novelty: 0.0395306
Score: 0.682
Data Source: STRINGDB
UTS2R
Tchem
Family: GPCR
Novelty: 0.01075176
Score: 0.678
Data Source: STRINGDB
NPBWR1
Tchem
Family: GPCR
Novelty: 0.02260656
Score: 0.647
Data Source: STRINGDB
ZSCAN10
Tdark
Family: TF
Novelty: 0.12898603
Score: 0.581
Data Source: STRINGDB
LHX9
Tbio
Family: TF
Novelty: 0.03191862
Score: 0.563
Data Source: STRINGDB
LHX1
Tbio
Family: TF
Novelty: 0.018877
Score: 0.553
Data Source: STRINGDB
SIM1
Tbio
Family: TF
Novelty: 0.0105279
Score: 0.551
Data Source: STRINGDB
MDK
Tchem
Novelty: 0.00179902
Score: 0.55
Data Source: STRINGDB
VDAC2
Tchem
Novelty: 0.00835655
Score: 0.548
Data Source: STRINGDB
Publication Statistics
PubMed Score  17.84

PubMed score by year
PubTator Score  5.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDC
1-70
FIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQQQAKLRLSAL
70-140
AASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSS
140-210
LGTGWPHVYGSAGMIDSATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPI
210-280
PTLLSNSPPSLSPTSSQTATSQSSPATPSETLTSPASALHSVAVH
280-325
MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQQQAKLRLSALAASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVYGSAGMIDSATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPIPTLLSNSPPSLSPTSSQTATSQSSPATPSETLTSPASALHSVAVH