You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BARD1
BRCA1-associated RING domain protein 1

Protein Summary
Description
E3 ubiquitin-protein ligase. The BRCA1-BARD1 heterodimer specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Plays a central role in the control of the cell cycle in response to DNA damage. Acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. Also forms a heterodimer with CSTF1/CSTF-50 to modulate mRNA processing and RNAP II stability by inhibiting pre-mRNA 3' cleavage. This gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor sup ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260947
  • ENSP00000260947
  • ENSG00000138376
  • ENST00000617164
  • ENSP00000480470
  • ENST00000620057
  • ENSP00000481988
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
0.92
protein domain
0.85
molecular function
0.79
biological process
0.78
protein complex
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 125.83   (req: < 5)
Gene RIFs: 105   (req: <= 3)
Antibodies: 271   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 125.83   (req: >= 5)
Gene RIFs: 105   (req: > 3)
Antibodies: 271   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (76)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 30
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle Checkpoints
Reactome
DNA Double Strand Break Response
Reactome
DNA Double-Strand Break Repair
Reactome
DNA Repair
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle Checkpoints
DNA Double Strand Break Response
DNA Double-Strand Break Repair
DNA Repair
Gene Ontology Terms (29)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (291)
1 – 10 of 291
BRCA1
Tchem
Novelty: 0.00014684
p_int: 1
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
ABRAXAS1
Tbio
Novelty: 0.13708072
Score: 0.999
Data Source: STRINGDB
RBBP8
Tbio
Family: Enzyme
Novelty: 0.00592293
Score: 0.996
Data Source: Reactome,STRINGDB
RAD51
Tchem
Novelty: 0.00014377
Score: 0.996
Data Source: Reactome,STRINGDB
MRE11
Tbio
Novelty: 0.00847079
Score: 0.995
Data Source: Reactome,STRINGDB
BRCA2
Tbio
Novelty: 0.00031192
Score: 0.994
Data Source: Reactome,STRINGDB
TOPBP1
Tbio
Family: Enzyme
Novelty: 0.00841288
Score: 0.993
Data Source: STRINGDB
NBN
Tbio
Novelty: 0.0085941
Score: 0.993
Data Source: Reactome,STRINGDB
BRCC3
Tbio
Family: Enzyme
Novelty: 0.06615415
Score: 0.991
Data Source: STRINGDB
RAD50
Tbio
Novelty: 0.03505258
Score: 0.989
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  125.83

PubMed score by year
PubTator Score  151.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIF
1-70
CSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSDLKEDKPRKSLFNDAGNKK
70-140
NSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSYEFVSPSPPADVSERAKKASARSGKKQKKKT
140-210
LAEINQKWNLEAEKEDGEFDSKEESKQKLVSFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSL
210-280
PLAEQIESPDTKSRNEVVTPEKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQ
280-350
TVPSENIPLPECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNM
350-420
AVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTT
420-490
GYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNESSSASHCSVM
490-560
NTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWI
560-630
LKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGG
630-700
QILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSF
700-770
ELLPLDS
770-777
MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSDLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSYEFVSPSPPADVSERAKKASARSGKKQKKKTLAEINQKWNLEAEKEDGEFDSKEESKQKLVSFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSLPLAEQIESPDTKSRNEVVTPEKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQTVPSENIPLPECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNMAVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS