You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
SIGMAR1
Sigma non-opioid intracellular receptor 1

Protein Summary
Description
Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane. Involved in the regulation of different receptors it plays a role in BDNF signaling and EGF signaling. Also regulates ion channels like the potassium channel and could modulate neurotransmitter release. Plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. Plays a role in several other cell functions including proliferation, survival and death. Originally identified for its ability to bind various psychoactive drugs it is involved in learning processes, memory and mood alteration (PubMed:16472803, PubMed:9341151). Necessary for proper mitochondrial axonal transport in motor neurons, in particular the retrograde movement of mitochondria. Plays a role in protecting cells against oxidative stress-induc ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000277010
  • ENSP00000277010
  • ENSG00000147955
  • ENST00000353468
  • ENSP00000434453
  • ENST00000477726
  • ENSP00000420022

Symbol
  • OPRS1
  • SRBP
  • SRBP
  • ALS16
  • DSMA2
  • OPRS1
  • SR-BP
  • SIG-1R
  • SR-BP1
  • sigma1R
  • hSigmaR1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.87
cellular component
0.86
transcription factor perturbation
0.8
disease perturbation
0.74
virus perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 239.16   (req: < 5)
Gene RIFs: 78   (req: <= 3)
Antibodies: 215   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 239.16   (req: >= 5)
Gene RIFs: 78   (req: > 3)
Antibodies: 215   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 1759
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 59
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (21)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (103)
1 – 10 of 103
RTN1
Tbio
Novelty: 0.02399548
p_int: 0.987619744
p_ni: 0.012380256
Score: 0.246
Data Source: BioPlex,STRINGDB
ADGRG5
Tdark
Family: GPCR
Novelty: 0.38877844
p_int: 0.969308644
p_ni: 0.030691356
Score: 0.177
Data Source: BioPlex,STRINGDB
CYP51A1
Tchem
Family: Enzyme
Novelty: 0.00143411
Score: 0.901
Data Source: STRINGDB
ERG28
Tbio
Novelty: 0.05657552
Score: 0.901
Data Source: STRINGDB
KCNH6
Tclin
Family: IC
Novelty: 0.01856828
Score: 0.9
Data Source: STRINGDB
SQLE
Tchem
Family: Enzyme
Novelty: 0.01030355
Score: 0.898
Data Source: STRINGDB
MSMO1
Tbio
Family: Enzyme
Novelty: 0.02010603
Score: 0.893
Data Source: STRINGDB
NSDHL
Tbio
Family: Enzyme
Novelty: 0.0267491
Score: 0.891
Data Source: STRINGDB
TM7SF2
Tbio
Family: Enzyme
Novelty: 0.06840948
Score: 0.802
Data Source: STRINGDB
KCNA4
Tclin
Family: IC
Novelty: 0.00458772
Score: 0.793
Data Source: STRINGDB
Publication Statistics
PubMed Score  239.16

PubMed score by year
PubTator Score  91.87

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHP
1-70
GHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGT
70-140
TKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGL
140-210
RLELTTYLFGQDP
210-223
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP