You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HSD17B10
3-hydroxyacyl-CoA dehydrogenase type-2

Protein Summary
Description
Mitochondrial dehydrogenase that catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone (PubMed:9553139, PubMed:23042678, PubMed:12917011, PubMed:18996107, PubMed:25925575, PubMed:28888424). Catalyzes the third step in the beta-oxidation of fatty acids (PubMed:9553139, PubMed:12917011, PubMed:18996107, PubMed:25925575, PubMed:28888424). Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids (PubMed:12917011). Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids (PubMed:12917011). By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD) (PubMed:9338779). Essential for structural and functional integrity of mitochondria (PubMed:20077426). In addition to mitochondrial dehydrogenase activity, moonlights as a component of mitochondrial ribonuclease P, a complex that cleaves tRNA molecule ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000168216
  • ENSP00000168216
  • ENSG00000072506
  • ENST00000375304
  • ENSP00000364453

Symbol
  • ERAB
  • HADH2
  • MRPP2
  • SCHAD
  • SDR5C1
  • XH98G2
  • ABAD
  • CAMR
  • ERAB
  • HCD2
  • MHBD
  • HADH2
  • MRPP2
  • MRX17
  • MRX31
  • SCHAD
  • MRXS10
  • SDR5C1
  • HSD10MD
  • 17b-HSD10
  • DUPXp11.22
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.99
disease perturbation
0.96
kinase perturbation
0.96
virus perturbation
0.92
transcription factor perturbation
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 152.94   (req: < 5)
Gene RIFs: 44   (req: <= 3)
Antibodies: 499   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 152.94   (req: >= 5)
Gene RIFs: 44   (req: > 3)
Antibodies: 499   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 7
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (29)
Branched-chain amino acid catabolism (R-HSA-70895)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Branched-chain amino acid catabolism
Reactome
Metabolism
Reactome
Metabolism of RNA
Reactome
Metabolism of amino acids and derivatives
Reactome
rRNA processing
Name
Explore in Pharos
Explore in Source
Branched-chain amino acid catabolism
Metabolism
Metabolism of RNA
Metabolism of amino acids and derivatives
rRNA processing
Gene Ontology Terms (19)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (160)
1 – 10 of 160
IGHG2
Tdark
p_int: 0.823348607
p_ni: 0.176574343
p_wrong: 0.000077049
Data Source: BioPlex
TRMT10C
Tbio
Family: Enzyme
Novelty: 0.15151515
p_int: 0.811403461
p_ni: 0.188596539
Score: 0.994
Data Source: BioPlex,Reactome,STRINGDB
IGHG1
Tdark
p_int: 0.760449348
p_ni: 0.239550652
Data Source: BioPlex
ECHS1
Tbio
Family: Enzyme
Novelty: 0.01956365
Score: 0.992
Data Source: STRINGDB
HADHB
Tbio
Family: Enzyme
Novelty: 0.01003327
Score: 0.99
Data Source: STRINGDB
KIAA0391
Tbio
Family: Enzyme
Novelty: 0.01337196
Score: 0.987
Data Source: Reactome,STRINGDB
ACAA2
Tbio
Family: Enzyme
Novelty: 0.02112232
Score: 0.972
Data Source: STRINGDB
ACAA1
Tbio
Family: Enzyme
Novelty: 0.00482727
Score: 0.944
Data Source: STRINGDB
HADH
Tbio
Family: Enzyme
Novelty: 0.00360431
Score: 0.942
Data Source: STRINGDB
HADHA
Tbio
Novelty: 0.00234785
Score: 0.942
Data Source: STRINGDB
Publication Statistics
PubMed Score  152.94

PubMed score by year
PubTator Score  162.31

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKD
1-70
VQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNE
70-140
PDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLP
140-210
EKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
210-261
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP