You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PITX2
Pituitary homeobox 2

Protein Summary
Description
Controls cell proliferation in a tissue-specific manner and is involved in morphogenesis. During embryonic development, exerts a role in the expansion of muscle progenitors. May play a role in the proper localization of asymmetric organs such as the heart and stomach. Isoform PTX2C is involved in left-right asymmetry the developing embryo (By similarity). This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306732
  • ENSP00000304169
  • ENSG00000164093
  • ENST00000354925
  • ENSP00000347004
  • ENST00000355080
  • ENSP00000347192
  • ENST00000394595
  • ENSP00000378095
  • ENST00000394598
  • ENSP00000378097
  • ENST00000613094
  • ENSP00000484763
  • ENST00000614423
  • ENSP00000481951
  • ENST00000616641
  • ENSP00000484909
  • ENST00000644743
  • ENSP00000495061

Symbol
  • ARP1
  • RGS
  • RIEG
  • RIEG1
  • RS
  • RGS
  • ARP1
  • Brx1
  • IDG2
  • IGDS
  • IHG2
  • PTX2
  • RIEG
  • ASGD4
  • IGDS2
  • IRID2
  • Otlx2
  • RIEG1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
molecular function
0.99
hub protein
0.98
PubMedID
0.88
transcription factor
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 529.35   (req: < 5)
Gene RIFs: 135   (req: <= 3)
Antibodies: 269   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 529.35   (req: >= 5)
Gene RIFs: 135   (req: > 3)
Antibodies: 269   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 31
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (37)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Reactome
TFAP2 (AP-2) family regulates transcription of other transcription factors
Reactome
Transcriptional regulation by the AP-2 (TFAP2) family of transcription factors
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
TFAP2 (AP-2) family regulates transcription of other transcription factors
Transcriptional regulation by the AP-2 (TFAP2) family of transcription factors
Gene Ontology Terms (34)
Items per page:
10
1 – 10 of 14
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (150)
1 – 10 of 150
AHCYL2
Tbio
Family: Enzyme
Novelty: 0.10791598
p_int: 0.999799889
p_ni: 0.000200111
Score: 0.303
Data Source: BioPlex,STRINGDB
LRRC46
Tdark
Novelty: 1.42857143
p_int: 0.995451646
p_ni: 0.004397955
p_wrong: 0.0001504
Score: 0.188
Data Source: BioPlex,STRINGDB
AHCYL1
Tchem
Family: Enzyme
Novelty: 0.01825604
p_int: 0.990644738
p_ni: 0.009223666
p_wrong: 0.000131597
Score: 0.787
Data Source: BioPlex,STRINGDB
IER2
Tbio
Novelty: 0.05396246
p_int: 0.99046107
p_ni: 4.17e-7
p_wrong: 0.009538513
Score: 0.193
Data Source: BioPlex,STRINGDB
LEF1
Tchem
Family: TF
Novelty: 0.00223818
Score: 0.982
Data Source: STRINGDB
CTNNB1
Tchem
Novelty: 0.00008951
Score: 0.981
Data Source: STRINGDB
PITX3
Tbio
Family: TF
Novelty: 0.00594085
Score: 0.963
Data Source: STRINGDB
KAT5
Tchem
Family: Epigenetic
Novelty: 0.00465028
Score: 0.946
Data Source: STRINGDB
TFAP2A
Tbio
Family: TF
Novelty: 0.0031574
Score: 0.944
Data Source: STRINGDB
CITED2
Tbio
Novelty: 0.0088691
Score: 0.94
Data Source: STRINGDB
Publication Statistics
PubMed Score  529.35

PubMed score by year
PubTator Score  512.42

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGK
1-70
NEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKW
70-140
RKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSM
140-210
FSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSS
210-280
LASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV
280-317
METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV