You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
P2RX4
P2X purinoceptor 4

Protein Summary
Description
Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin. The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS. The product of this gene has the lowest sensitivity for these antagonists. Multiple alternatively spliced transcript variants, some protein-coding and some not protein-coding, have been found for this gene. [provided by RefSeq, Feb 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000337233
  • ENSP00000336607
  • ENSG00000135124
  • ENST00000359949
  • ENSP00000353032
  • ENST00000542067
  • ENSP00000438329

Symbol
  • P2X4
  • P2X4R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
biological process
0.96
cellular component
0.88
transcription factor perturbation
0.84
histone modification site profile
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 344.81   (req: < 5)
Gene RIFs: 53   (req: <= 3)
Antibodies: 240   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 344.81   (req: >= 5)
Gene RIFs: 53   (req: > 3)
Antibodies: 240   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 47
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 6
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Pathways (6)
Elevation of cytosolic Ca2+ levels (R-HSA-139853)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Elevation of cytosolic Ca2+ levels
Reactome
Hemostasis
Reactome
Platelet calcium homeostasis
Reactome
Platelet homeostasis
Name
Explore in Pharos
Explore in Source
Elevation of cytosolic Ca2+ levels
Hemostasis
Platelet calcium homeostasis
Platelet homeostasis
Gene Ontology Terms (61)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Non-traceable Author Statement (NAS)
BHF-UCL
Inferred by Curator (IC)
BHF-UCL
Protein-Protein Interactions (84)
1 – 10 of 84
CYBC1
Tdark
Novelty: 0.49659864
p_int: 0.999979184
p_ni: 0.000020769
p_wrong: 4.7e-8
Score: 0.235
Data Source: BioPlex,STRINGDB
B3GALT5
Tbio
Family: Enzyme
Novelty: 0.05431281
p_int: 0.999968548
p_ni: 0.000031318
p_wrong: 1.34e-7
Data Source: BioPlex
SPPL2B
Tbio
Family: Enzyme
Novelty: 0.03749833
p_int: 0.999903309
p_ni: 0.000096569
p_wrong: 1.22e-7
Data Source: BioPlex
FAM20B
Tdark
Family: Enzyme
Novelty: 0.13513514
p_int: 0.999499577
p_ni: 0.000500417
p_wrong: 6e-9
Score: 0.518
Data Source: BioPlex,STRINGDB
PIGH
Tbio
Family: Enzyme
Novelty: 0.05999571
p_int: 0.999040372
p_ni: 0.00084138
p_wrong: 0.000118248
Score: 0.235
Data Source: BioPlex,STRINGDB
CSGALNACT2
Tbio
Family: Enzyme
Novelty: 0.1003811
p_int: 0.998733181
p_ni: 0.00036208
p_wrong: 0.000904739
Data Source: BioPlex
EIF2B3
Tbio
Novelty: 0.05806987
p_int: 0.996952978
p_ni: 0.003047022
Data Source: BioPlex
EIF2B5
Tbio
Novelty: 0.01114599
p_int: 0.993729264
p_ni: 0.006270736
Score: 0.196
Data Source: BioPlex,STRINGDB
TNPO3
Tbio
Novelty: 0.01656362
p_int: 0.968982129
p_ni: 0.031017871
Data Source: BioPlex
EIF2B4
Tbio
Novelty: 0.07295839
p_int: 0.958370796
p_ni: 0.041629204
Data Source: BioPlex
Publication Statistics
PubMed Score  344.81

PubMed score by year
PubTator Score  162.68

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKG
1-70
VAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTH
70-140
SNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNIT
140-210
TTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLD
210-280
TRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMAT
280-350
VLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ
350-388
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ