You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MPHOSPH6
M-phase phosphoprotein 6

Protein Summary
Description
RNA-binding protein that associates with the RNA exosome complex. Involved in the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and play a role in recruiting the RNA exosome complex to pre-rRNA; this function may include C1D.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000258169
  • ENSP00000258169
  • ENSG00000135698

Symbol
  • MPP6
  • MPP
  • MPP6
  • MPP-6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.85
virus perturbation
0.79
transcription factor binding site profile
0.72
cellular component
0.66
disease perturbation
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.8   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 161   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.8   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 161   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Major pathway of rRNA processing in the nucleolus and cytosol
Reactome
Metabolism of RNA
Reactome
rRNA processing
Reactome
rRNA processing in the nucleus and cytosol
Name
Explore in Pharos
Explore in Source
Major pathway of rRNA processing in the nucleolus and cytosol
Metabolism of RNA
rRNA processing
rRNA processing in the nucleus and cytosol
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (157)
1 – 10 of 157
ZFC3H1
Tdark
Novelty: 0.234375
p_int: 0.999999922
p_ni: 7.7e-8
Score: 0.931
Data Source: BioPlex,STRINGDB
C1D
Tbio
Novelty: 0.01491795
p_int: 0.999995418
p_ni: 0.000004583
Score: 0.986
Data Source: BioPlex,Reactome,STRINGDB
WDR3
Tbio
Novelty: 0.18709843
p_int: 0.999993834
p_ni: 0.000006166
Score: 0.904
Data Source: BioPlex,STRINGDB
ZNF106
Tbio
Novelty: 0.19099591
p_int: 0.999984523
p_ni: 0.000015477
Data Source: BioPlex
EXOSC3
Tbio
Novelty: 0.05171042
p_int: 0.999970761
p_ni: 0.00002924
Score: 0.999
Data Source: BioPlex,STRINGDB
PWP2
Tbio
Novelty: 0.04608969
p_int: 0.999968047
p_ni: 0.000031953
Score: 0.904
Data Source: BioPlex,STRINGDB
EXOSC1
Tbio
Novelty: 0.00777274
p_int: 0.99993668
p_ni: 0.00006332
Score: 0.999
Data Source: BioPlex,STRINGDB
RBM7
Tbio
Novelty: 0.10889292
p_int: 0.999933258
p_ni: 0.000066743
Data Source: BioPlex
EXOSC4
Tbio
Family: Enzyme
Novelty: 0.00986567
p_int: 0.999916014
p_ni: 0.000083986
Score: 0.998
Data Source: BioPlex,STRINGDB
EXOSC10
Tbio
Novelty: 0.00314743
p_int: 0.999872872
p_ni: 0.000127128
Score: 0.995
Data Source: BioPlex,Reactome,STRINGDB
Publication Statistics
PubMed Score  2.80

PubMed score by year
PubTator Score  19.69

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDL
1-70
LYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEE
70-140
DENGDITPIKAKKMFLKPQD
140-160
MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD