You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PLIN2
Perilipin-2

Protein Summary
Description
May be involved in development and maintenance of adipose tissue. The protein encoded by this gene belongs to the perilipin family, members of which coat intracellular lipid storage droplets. This protein is associated with the lipid globule surface membrane material, and maybe involved in development and maintenance of adipose tissue. However, it is not restricted to adipocytes as previously thought, but is found in a wide range of cultured cell lines, including fibroblasts, endothelial and epithelial cells, and tissues, such as lactating mammary gland, adrenal cortex, Sertoli and Leydig cells, and hepatocytes in alcoholic liver cirrhosis, suggesting that it may serve as a marker of lipid accumulation in diverse cell types and diseases. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000276914
  • ENSP00000276914
  • ENSG00000147872

Symbol
  • ADFP
  • ADFP
  • ADRP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.97
small molecule perturbation
0.97
transcription factor perturbation
0.97
disease
0.92
PubMedID
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 435.48   (req: < 5)
Gene RIFs: 71   (req: <= 3)
Antibodies: 837   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 435.48   (req: >= 5)
Gene RIFs: 71   (req: > 3)
Antibodies: 837   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (13)
Autophagy (R-HSA-9612973)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Autophagy
Reactome
Chaperone Mediated Autophagy
Reactome
Lipophagy
Reactome
Metabolism
Reactome
Metabolism of lipids
Name
Explore in Pharos
Explore in Source
Autophagy
Chaperone Mediated Autophagy
Lipophagy
Metabolism
Metabolism of lipids
Gene Ontology Terms (11)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (143)
1 – 10 of 143
PPARA
Tclin
Family: NR
Novelty: 0.00026802
Score: 0.951
Data Source: STRINGDB
FABP1
Tchem
Novelty: 0.002508
Score: 0.943
Data Source: STRINGDB
RXRA
Tclin
Family: NR
Novelty: 0.00314166
Score: 0.923
Data Source: STRINGDB
ABHD5
Tbio
Family: Enzyme
Novelty: 0.00998736
Score: 0.909
Data Source: STRINGDB
NCOA1
Tchem
Family: Epigenetic
Novelty: 0.00427551
Score: 0.906
Data Source: STRINGDB
NCOA2
Tbio
Novelty: 0.00643607
Score: 0.904
Data Source: STRINGDB
CREBBP
Tchem
Family: Epigenetic
Novelty: 0.00127032
Score: 0.902
Data Source: STRINGDB
HELZ2
Tdark
Family: Enzyme
Novelty: 0.28753695
Score: 0.902
Data Source: STRINGDB
MED1
Tbio
Family: Enzyme
Novelty: 0.01259825
Score: 0.902
Data Source: STRINGDB
CHD9
Tbio
Family: Epigenetic
Novelty: 0.10573131
Score: 0.901
Data Source: STRINGDB
Publication Statistics
PubMed Score  435.48

PubMed score by year
PubTator Score  297.89

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASVAVDPQPSVVTRVVNLPLVSSTYDLMSSAYLSTKDQYPYLKSVCEMAENGVKTITSVAMTSALPIIQ
1-70
KLEPQIAVANTYACKGLDRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDK
70-140
TKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDL
140-210
VQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDK
210-280
LYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMA
280-350
GDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGA
350-420
EMDKSSQETQRSEHKTH
420-437
MASVAVDPQPSVVTRVVNLPLVSSTYDLMSSAYLSTKDQYPYLKSVCEMAENGVKTITSVAMTSALPIIQKLEPQIAVANTYACKGLDRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH