You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CNN2
Calponin-2

Protein Summary
Description
Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity. The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several pseudogenes of this gene have been identified, and are present on chromosomes 1, 2, 3, 6, 9, 11, 13, 15, 16, 21 and 22. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263097
  • ENSP00000263097
  • ENSG00000064666
  • ENST00000348419
  • ENSP00000340129
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.95
transcription factor perturbation
0.94
disease perturbation
0.87
PubMedID
0.86
kinase perturbation
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.6   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 372   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.6   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 372   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (162)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Interleukin-12 family signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation
Immune System
Innate Immune System
Interleukin-12 family signaling
Gene Ontology Terms (17)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (139)
1 – 10 of 139
CNN3
Tbio
Novelty: 0.05974864
p_int: 1
Score: 0.529
Data Source: BioPlex,STRINGDB
NAGK
Tbio
Family: Kinase
Novelty: 0.02300466
p_int: 0.986073893
p_ni: 0.013926103
p_wrong: 4e-9
Score: 0.199
Data Source: BioPlex,STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.95853588
p_ni: 0.04146412
Data Source: BioPlex
ATE1
Tbio
Family: Enzyme
Novelty: 0.0119888
p_int: 0.956553828
p_ni: 0.043446171
p_wrong: 1e-9
Score: 0.196
Data Source: BioPlex,STRINGDB
ALAD
Tbio
Family: Enzyme
Novelty: 0.00093006
p_int: 0.886005505
p_ni: 0.000083713
p_wrong: 0.113910782
Score: 0.356
Data Source: BioPlex,STRINGDB
TRAPPC4
Tbio
Novelty: 0.12910497
p_int: 0.863961211
p_ni: 0.135733243
p_wrong: 0.000305547
Data Source: BioPlex
VCL
Tbio
Novelty: 0.00044707
Score: 0.954
Data Source: STRINGDB
FSCN1
Tbio
Novelty: 0.00112091
Score: 0.945
Data Source: STRINGDB
CHIT1
Tbio
Family: Enzyme
Novelty: 0.00131999
Score: 0.935
Data Source: STRINGDB
DBNL
Tbio
Novelty: 0.04018498
Score: 0.925
Data Source: STRINGDB
Publication Statistics
PubMed Score  16.60

PubMed score by year
PubTator Score  10.77

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPG
1-70
SVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGV
70-140
DIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQM
140-210
GTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVA
210-280
DGAPSGTGDCPDPGEVPEYPPYYQEEAGY
280-309
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY