You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
UHRF1
E3 ubiquitin-protein ligase UHRF1

Protein Summary
Description
Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD-type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000612630
  • ENSP00000484739
  • ENSG00000276043
  • ENST00000615884
  • ENSP00000478601
  • ENST00000616255
  • ENSP00000478348
  • ENST00000624301
  • ENSP00000485604

Symbol
  • ICBP90
  • NP95
  • RNF106
  • Np95
  • hNP95
  • ICBP90
  • RNF106
  • TDRD22
  • hUHRF1
  • huNp95
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
protein domain
1
interacting protein
0.95
small molecule perturbation
0.9
biological process
0.89


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 189.03   (req: < 5)
Gene RIFs: 126   (req: <= 3)
Antibodies: 361   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 189.03   (req: >= 5)
Gene RIFs: 126   (req: > 3)
Antibodies: 361   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (27)
1 – 5 of 27
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
DNA methylation (R-HSA-5334118)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
DNA methylation
Reactome
Epigenetic regulation of gene expression
Reactome
Gene expression (Transcription)
Name
Explore in Pharos
Explore in Source
DNA methylation
Epigenetic regulation of gene expression
Gene expression (Transcription)
Gene Ontology Terms (31)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (249)
1 – 10 of 249
DPPA3
Tbio
Novelty: 0.00062711
p_int: 0.99999981
p_ni: 1.88e-7
p_wrong: 2e-9
Score: 0.43
Data Source: BioPlex,STRINGDB
TCEAL1
Tbio
Novelty: 0.03807394
p_int: 0.999999134
p_ni: 8.65e-7
p_wrong: 1e-9
Data Source: BioPlex
ZNF18
Tdark
Family: TF
Novelty: 0.39186134
p_int: 0.999964575
p_ni: 0.000035425
Score: 0.188
Data Source: BioPlex,STRINGDB
CCNDBP1
Tbio
Novelty: 0.02585442
p_int: 0.999897965
p_ni: 0.000102034
Score: 0.177
Data Source: BioPlex,STRINGDB
WIPI1
Tbio
Novelty: 0.01810583
p_int: 0.999882176
p_ni: 0.000117824
Score: 0.222
Data Source: BioPlex,STRINGDB
TRPV5
Tchem
Family: IC
Novelty: 0.00701642
p_int: 0.999741611
p_ni: 0.00025838
p_wrong: 8e-9
Score: 0.163
Data Source: BioPlex,STRINGDB
ARIH1
Tbio
Family: Enzyme
Novelty: 0.00502889
p_int: 0.999271969
p_ni: 0.000727947
p_wrong: 8.4e-8
Score: 0.223
Data Source: BioPlex,STRINGDB
TMCC2
Tdark
Novelty: 0.26054591
p_int: 0.999027767
p_ni: 0.000970241
p_wrong: 0.000001992
Score: 0.163
Data Source: BioPlex,STRINGDB
HIST1H3A
Tbio
Novelty: 0.01912636
p_int: 0.998842584
p_ni: 0.001157416
Score: 0.862
Data Source: BioPlex,Reactome,STRINGDB
RYDEN
Tdark
Novelty: 0.11278195
p_int: 0.998136903
p_ni: 0.001863097
Data Source: BioPlex
Publication Statistics
PubMed Score  189.03

PubMed score by year
PubTator Score  151.9

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQ
1-70
LLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEY
70-140
VDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARART
140-210
IIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKI
210-280
ERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLS
280-350
SVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGP
350-420
IPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNK
420-490
RTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYK
490-560
VVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEE
560-630
EQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLAS
630-700
LKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSY
700-770
AMQVNQPLQTVLNQLFPGYGNGR
770-793
MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR