You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NMNAT3
Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3

Protein Summary
Description
Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency. Can use triazofurin monophosphate (TrMP) as substrate. Can also use GTP and ITP as nucleotide donors. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+). For the pyrophosphorolytic activity, can use NAD(+), NADH, NaAD, nicotinic acid adenine dinucleotide phosphate (NHD), nicotinamide guanine dinucleotide (NGD) as substrates. Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NaADP(+). Protects against axonal degeneration following injury. This gene encodes a member of the nicotinamide/nicotinic acid mononucleotide adenylyltransferase family. These enzymes use ATP to catalyze the synthesis of nicotinamide adenine dinucleotide or nicotinic acid adenine dinucleotide from nicotinamide mononucleotide or nicotinic acid mononucleotide, respectively. The encod ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296202
  • ENSP00000296202
  • ENSG00000163864
  • ENST00000339837
  • ENSP00000340523
  • ENST00000413939
  • ENSP00000412953

Symbol
  • PNAT3
  • FKSG76
  • PNAT-3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.9
tissue sample
0.73
histone modification site profile
0.62
pathway
0.6
PubMedID
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.43   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 173   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.43   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 173   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of vitamins and cofactors
Reactome
Metabolism of water-soluble vitamins and cofactors
Reactome
Nicotinate metabolism
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of vitamins and cofactors
Metabolism of water-soluble vitamins and cofactors
Nicotinate metabolism
Protein-Protein Interactions (60)
1 – 10 of 60
DCX
Tbio
Novelty: 0.00086625
p_int: 0.999995348
p_ni: 2.45e-7
p_wrong: 0.000004408
Score: 0.543
Data Source: BioPlex,STRINGDB
HS2ST1
Tbio
Family: Enzyme
Novelty: 0.06029259
p_int: 0.999800202
p_ni: 0.000016053
p_wrong: 0.000183745
Score: 0.228
Data Source: BioPlex,STRINGDB
SPTB
Tbio
Novelty: 0.0031907
p_int: 0.999466128
p_ni: 0.000036163
p_wrong: 0.000497708
Score: 0.218
Data Source: BioPlex,STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.917292897
p_ni: 0.082707103
Data Source: BioPlex
NADSYN1
Tbio
Family: Enzyme
Novelty: 0.05610136
Score: 0.981
Data Source: STRINGDB
NADK
Tbio
Family: Kinase
Novelty: 0.05031447
Score: 0.974
Data Source: STRINGDB
NAPRT
Tbio
Family: Enzyme
Novelty: 0.05728379
Score: 0.973
Data Source: STRINGDB
NAMPT
Tchem
Family: Enzyme
Novelty: 0.00099567
Score: 0.971
Data Source: STRINGDB
NMRK1
Tbio
Family: Kinase
Novelty: 0.07997461
Score: 0.969
Data Source: STRINGDB
QPRT
Tbio
Family: Enzyme
Novelty: 0.00969466
Score: 0.963
Data Source: STRINGDB
Publication Statistics
PubMed Score  24.43

PubMed score by year
PubTator Score  8.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARL
1-70
ALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLK
70-140
TFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALG
140-210
QGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS
210-252
MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS