You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
WRNIP1
ATPase WRNIP1

Protein Summary
Description
Functions as a modulator of initiation or reinitiation events during DNA polymerase delta-mediated DNA synthesis. In the presence of ATP, stimulation of DNA polymerase delta-mediated DNA synthesis is decreased. Plays also a role in the innate immune defense against viruses. Stabilizes the RIG-I/DDX58 dsRNA interaction and promotes RIG-I/DDX58 'Lys-63'-linked polyubiquitination. In turn, RIG-I/DDX58 transmits the signal through mitochondrial MAVS. Werner's syndrome is a rare autosomal recessive disorder characterized by accelerated aging that is caused by defects in the Werner syndrome ATP-dependent helicase gene (WRN). The protein encoded by this gene interacts with the exonuclease-containing N-terminal portion of the Werner protein. This protein has a ubiquitin-binding zinc-finger domain in the N-terminus, an ATPase domain, and two leucine zipper motifs in the C-terminus. It has sequence similarity to replication factor C family proteins and is conserved from E. coli to human. This pr ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000380764
  • ENSP00000370141
  • ENSG00000124535
  • ENST00000380769
  • ENSP00000370146
  • ENST00000380771
  • ENSP00000370148
  • ENST00000380773
  • ENSP00000370150
  • ENST00000618555
  • ENSP00000477551

Symbol
  • WHIP
  • WHIP
  • bA420G6.2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein complex
1
ligand (protein) perturbation
0.99
molecular function
0.96
interacting protein
0.93
transcription factor binding site profile
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 378.54   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 215   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 378.54   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 215   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (19)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (74)
1 – 10 of 74
WRN
Tbio
Family: Enzyme
Novelty: 0.00183623
Score: 0.97
Data Source: STRINGDB
RAD18
Tbio
Family: Enzyme
Novelty: 0.00575302
Score: 0.955
Data Source: STRINGDB
BLM
Tchem
Novelty: 0.00886045
Score: 0.881
Data Source: STRINGDB
FGFR1OP
Tbio
Novelty: 0.19993673
Score: 0.7
Data Source: STRINGDB
ATMIN
Tbio
Novelty: 0.04858019
Score: 0.693
Data Source: STRINGDB
BRCA1
Tchem
Novelty: 0.00014684
Score: 0.683
Data Source: STRINGDB
HLTF
Tbio
Family: Enzyme
Novelty: 0.01410809
Score: 0.682
Data Source: STRINGDB
TRIR
Tdark
Novelty: 0.00683605
Score: 0.666
Data Source: STRINGDB
MCM7
Tbio
Novelty: 0.00227245
Score: 0.661
Data Source: STRINGDB
TP53BP1
Tbio
Family: Epigenetic
Novelty: 0.0017892
Score: 0.659
Data Source: STRINGDB
Publication Statistics
PubMed Score  378.54

PubMed score by year
PubTator Score  13.89

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEVSGPEDDPFLSQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAGHAEPAAGSHRAGERAKGPSPPGAK
1-70
RRRLSESSALKQPATPTAAESSEGEGEEGDDGGETESRESYDAPPTPSGARLIPDFPVARSSSPGRKGSG
70-140
KRPAAAAAAGSASPRSWDEAEAQEEEEAVGDGDGDGDADADGEDDPGHWDADAAEAATAFGASGGGRPHP
140-210
RALAAEEIRQMLQGKPLADTMRPDTLQDYFGQSKAVGQDTLLRSLLETNEIPSLILWGPPGCGKTTLAHI
210-280
IASNSKKHSIRFVTLSATNAKTNDVRDVIKQAQNEKSFFKRKTILFIDEIHRFNKSQQDTFLPHVECGTI
280-350
TLIGATTENPSFQVNAALLSRCRVIVLEKLPVEAMVTILMRAINSLGIHVLDSSRPTDPLSHSSNSSSEP
350-420
AMFIEDKAVDTLAYLSDGDARAGLNGLQLAVLARLSSRKMFCKKSGQSYSPSRVLITENDVKEGLQRSHI
420-490
LYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASEDIGLADPSALTQAVA
490-560
AYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRNHQGPLPPVPLHLRNAPTRLMKDLG
560-630
YGKGYKYNPMYSEPVDQEYLPEELRGVDFFKQRRC
630-665
MEVSGPEDDPFLSQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAGHAEPAAGSHRAGERAKGPSPPGAKRRRLSESSALKQPATPTAAESSEGEGEEGDDGGETESRESYDAPPTPSGARLIPDFPVARSSSPGRKGSGKRPAAAAAAGSASPRSWDEAEAQEEEEAVGDGDGDGDADADGEDDPGHWDADAAEAATAFGASGGGRPHPRALAAEEIRQMLQGKPLADTMRPDTLQDYFGQSKAVGQDTLLRSLLETNEIPSLILWGPPGCGKTTLAHIIASNSKKHSIRFVTLSATNAKTNDVRDVIKQAQNEKSFFKRKTILFIDEIHRFNKSQQDTFLPHVECGTITLIGATTENPSFQVNAALLSRCRVIVLEKLPVEAMVTILMRAINSLGIHVLDSSRPTDPLSHSSNSSSEPAMFIEDKAVDTLAYLSDGDARAGLNGLQLAVLARLSSRKMFCKKSGQSYSPSRVLITENDVKEGLQRSHILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASEDIGLADPSALTQAVAAYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRNHQGPLPPVPLHLRNAPTRLMKDLGYGKGYKYNPMYSEPVDQEYLPEELRGVDFFKQRRC