You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MED15
Mediator of RNA polymerase II transcription subunit 15

Protein Summary
Description
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for cholesterol-dependent gene regulation. Positively regulates the Nodal signaling pathway. The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Alternative splicing results in multiple transcript variants. [provided ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263205
  • ENSP00000263205
  • ENSG00000099917
  • ENST00000292733
  • ENSP00000292733
  • ENST00000382974
  • ENSP00000372434

Symbol
  • ARC105
  • CTG7A
  • PCQAP
  • TIG1
  • TNRC7
  • TIG1
  • CAG7A
  • CTG7A
  • PCQAP
  • TIG-1
  • TNRC7
  • ARC105
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.83
cell type or tissue
0.81
hub protein
0.79
small molecule perturbation
0.69
cell line
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 40.8   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 225   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 40.8   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 225   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Metabolism
Reactome
Metabolism of lipids
Name
Explore in Pharos
Explore in Source
Developmental Biology
Gene expression (Transcription)
Generic Transcription Pathway
Metabolism
Metabolism of lipids
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (143)
1 – 10 of 143
MED19
Tbio
Family: Enzyme
Novelty: 0.0129406
p_int: 0.999990249
p_ni: 0.000009751
Score: 0.997
Data Source: BioPlex,STRINGDB
MED21
Tbio
Family: Enzyme
Novelty: 0.07350796
p_int: 0.999986558
p_ni: 0.000013442
Score: 0.989
Data Source: BioPlex,STRINGDB
MED17
Tbio
Family: Enzyme
Novelty: 0.02150905
p_int: 0.99998409
p_ni: 0.000015909
p_wrong: 1e-9
Score: 0.998
Data Source: BioPlex,STRINGDB
MED10
Tdark
Family: Enzyme
Novelty: 0.04266486
p_int: 0.999977458
p_ni: 0.000022542
Score: 0.997
Data Source: BioPlex,STRINGDB
MED1
Tbio
Family: Enzyme
Novelty: 0.01259825
p_int: 0.999967171
p_ni: 0.000032829
Score: 0.999
Data Source: BioPlex,STRINGDB
MED28
Tbio
Family: Enzyme
Novelty: 0.00538886
p_int: 0.999965822
p_ni: 0.000034178
Score: 0.999
Data Source: BioPlex,STRINGDB
MED18
Tbio
Family: Enzyme
Novelty: 0.00819084
p_int: 0.999940985
p_ni: 0.000059015
Score: 0.999
Data Source: BioPlex,STRINGDB
MED4
Tbio
Family: Enzyme
Novelty: 0.01983752
p_int: 0.999907599
p_ni: 0.000092401
Score: 0.997
Data Source: BioPlex,STRINGDB
CCNC
Tbio
Novelty: 0.00627488
p_int: 0.999871976
p_ni: 0.000128024
Score: 0.994
Data Source: BioPlex,STRINGDB
MED20
Tbio
Family: Enzyme
Novelty: 0.02451628
p_int: 0.999637103
p_ni: 0.000362896
p_wrong: 1e-9
Score: 0.996
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  40.80

PubMed score by year
PubTator Score  29.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIH
1-70
NKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQPPPGTSGMAPHS
70-140
MAVVSTATPQTQLQLQQVALQQQQQQQQFQQQQQAALQQQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQL
140-210
QQQQQQQQHLIKLHHQNQQQIQQQQQQLQRIAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQP
210-280
PPSQALPQQLQQMHHTQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRA
280-350
PMVVQQPPVQPQVQQQQTAVQTAQAAQMVAPGVQMITEALAQGGMHIRARFPPTTAVSAIPSSSIPLGRQ
350-420
PMAQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQ
420-490
SPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRK
490-560
KDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIR
560-630
SPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSN
630-700
NGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVT
700-770
ALLNTWAQSVHQACLSAA
770-788
MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQPPPGTSGMAPHSMAVVSTATPQTQLQLQQVALQQQQQQQQFQQQQQAALQQQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLHHQNQQQIQQQQQQLQRIAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQMHHTQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRAPMVVQQPPVQPQVQQQQTAVQTAQAAQMVAPGVQMITEALAQGGMHIRARFPPTTAVSAIPSSSIPLGRQPMAQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSVHQACLSAA