You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PANX3
Pannexin-3

Protein Summary
Description
Structural component of the gap junctions and the hemichannels. The protein encoded by this gene belongs to the innexin family. Innexin family members are known to be the structural components of gap junctions. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000284288
  • ENSP00000284288
  • ENSG00000154143

Symbol
  • PX3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue
0.61
cell line
0.57
cell type or tissue
0.53
gene perturbation
0.53
cellular component
0.44


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 93.02   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 85   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 93.02   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 85   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (46)
1 – 10 of 46
GJA1
Tbio
Novelty: 0.00023576
Score: 0.833
Data Source: STRINGDB
GJB1
Tbio
Novelty: 0.00115116
Score: 0.795
Data Source: STRINGDB
GJD2
Tbio
Novelty: 0.00313559
Score: 0.768
Data Source: STRINGDB
LRRC8A
Tbio
Novelty: 0.01849951
Score: 0.761
Data Source: STRINGDB
GJC1
Tbio
Novelty: 0.00506104
Score: 0.757
Data Source: STRINGDB
GJB2
Tbio
Novelty: 0.00063266
Score: 0.753
Data Source: STRINGDB
GJB6
Tbio
Novelty: 0.00160827
Score: 0.687
Data Source: STRINGDB
CALHM1
Tbio
Family: IC
Novelty: 0.02026846
Score: 0.682
Data Source: STRINGDB
GJA8
Tbio
Novelty: 0.00138739
Score: 0.677
Data Source: STRINGDB
GJE1
Tdark
Novelty: 0.29459902
Score: 0.673
Data Source: STRINGDB
Publication Statistics
PubMed Score  93.02

PubMed score by year
PubTator Score  26.84

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSLAHTAAEYMLSDALLPDRRGPRLKGLRLELPLDRIVKFVAVGSPLLLMSLAFAQEFSSGSPISCFSPS
1-70
NFSIRQAAYVDSSCWDSLLHHKQDGPGQDKMKSLWPHKALPYSLLALALLMYLPVLLWQYAAVPALSSDL
70-140
LFIISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLLERYLACKQRSHSLVATYL
140-210
LRNSLLLIFTSATYLYLGHFHLDVFFQEEFSCSIKTGLLSDETHVPNLITCRLTSLSIFQIVSLSSVAIY
210-280
TILVPVIIYNLTRLCRWDKRLLSVYEMLPAFDLLSRKMLGCPINDLNVILLFLRANISELISFSWLSVLC
280-350
VLKDTTTQKHNIDTVVDFMTLLAGLEPSKPKHLTNSACDEHP
350-392
MSLAHTAAEYMLSDALLPDRRGPRLKGLRLELPLDRIVKFVAVGSPLLLMSLAFAQEFSSGSPISCFSPSNFSIRQAAYVDSSCWDSLLHHKQDGPGQDKMKSLWPHKALPYSLLALALLMYLPVLLWQYAAVPALSSDLLFIISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLLERYLACKQRSHSLVATYLLRNSLLLIFTSATYLYLGHFHLDVFFQEEFSCSIKTGLLSDETHVPNLITCRLTSLSIFQIVSLSSVAIYTILVPVIIYNLTRLCRWDKRLLSVYEMLPAFDLLSRKMLGCPINDLNVILLFLRANISELISFSWLSVLCVLKDTTTQKHNIDTVVDFMTLLAGLEPSKPKHLTNSACDEHP