You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC2A13
Proton myo-inositol cotransporter

Protein Summary
Description
H(+)-myo-inositol cotransporter. Can also transport related stereoisomers.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000280871
  • ENSP00000280871
  • ENSG00000151229

Symbol
  • HMIT
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.93
histone modification site profile
0.78
transcription factor perturbation
0.74
transcription factor binding site profile
0.67
cell type or tissue
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.26   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 109   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.26   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 109   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Inositol transporters (R-HSA-429593)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Inositol transporters
Reactome
SLC-mediated transmembrane transport
Reactome
Transport of bile salts and organic acids, metal ions and amine compounds
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Inositol transporters
SLC-mediated transmembrane transport
Transport of bile salts and organic acids, metal ions and amine compounds
Transport of small molecules
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (165)
1 – 10 of 165
RIOK3
Tchem
Family: Kinase
Novelty: 0.07096405
p_int: 0.999995102
p_ni: 0.000004822
p_wrong: 7.6e-8
Data Source: BioPlex
ATG9A
Tbio
Novelty: 0.02725439
p_int: 0.874777766
p_ni: 0.125219205
p_wrong: 0.000003029
Data Source: BioPlex
BLK
Tchem
Family: Kinase
Novelty: 0.00922757
p_int: 0.815024164
p_ni: 0.180591899
p_wrong: 0.004383937
Data Source: BioPlex
POLR2J
Tbio
Family: Enzyme
Novelty: 0.03501746
Score: 0.771
Data Source: STRINGDB
POLR2J3
Tdark
Family: Enzyme
Novelty: 2
Score: 0.771
Data Source: STRINGDB
POLR2J2
Tdark
Family: Enzyme
Novelty: 2
Score: 0.771
Data Source: STRINGDB
POLR2E
Tbio
Family: Enzyme
Novelty: 0.02478824
Score: 0.757
Data Source: STRINGDB
BUD13
Tbio
Novelty: 0.06933519
Score: 0.757
Data Source: STRINGDB
POLR2C
Tbio
Family: Enzyme
Novelty: 0.03387776
Score: 0.757
Data Source: STRINGDB
SNW1
Tbio
Novelty: 0.01975138
Score: 0.757
Data Source: STRINGDB
Publication Statistics
PubMed Score  13.26

PubMed score by year
PubTator Score  8.76

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSRKASENVEYTLRSLSSLMGERRRKQPEPDAASAAGECSLLAAAESSTSLQSAGAGGGGVGDLERAARR
1-70
QFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQELLVSSTVGAAAVSALAGGA
70-140
LNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVT
140-210
INTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILS
210-280
QMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSAT
280-350
ILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSP
350-420
RITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFK
420-490
TEDIFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVS
490-560
LTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYI
560-630
RVKGSNYHLSDNDASDVE
630-648
MSRKASENVEYTLRSLSSLMGERRRKQPEPDAASAAGECSLLAAAESSTSLQSAGAGGGGVGDLERAARRQFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQELLVSSTVGAAAVSALAGGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKTEDIFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE