You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC38A2
Sodium-coupled neutral amino acid transporter 2

Protein Summary
Description
Functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. May function in the transport of amino acids at the blood-brain barrier and in the supply of maternal nutrients to the fetus through the placenta.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000256689
  • ENSP00000256689
  • ENSG00000134294
  • ENST00000612232
  • ENSP00000482873

Symbol
  • ATA2
  • KIAA1382
  • SAT2
  • SNAT2
  • ATA2
  • SAT2
  • SNAT2
  • PRO1068
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.98
PubMedID
0.88
cell type or tissue
0.78
microRNA
0.77
virus perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 93.72   (req: < 5)
Gene RIFs: 26   (req: <= 3)
Antibodies: 119   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 93.72   (req: >= 5)
Gene RIFs: 26   (req: > 3)
Antibodies: 119   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (50)
Amino acid transport across the plasma membrane (R-HSA-352230)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amino acid transport across the plasma membrane
Reactome
Glutamate Neurotransmitter Release Cycle
Reactome
Neuronal System
Reactome
Neurotransmitter release cycle
Reactome
SLC-mediated transmembrane transport
Name
Explore in Pharos
Explore in Source
Amino acid transport across the plasma membrane
Glutamate Neurotransmitter Release Cycle
Neuronal System
Neurotransmitter release cycle
SLC-mediated transmembrane transport
Protein-Protein Interactions (74)
1 – 10 of 74
TNFRSF10C
Tbio
Novelty: 0.00061543
p_int: 0.967093119
p_ni: 0.03290649
p_wrong: 3.91e-7
Data Source: BioPlex
TSPAN5
Tbio
Novelty: 0.13109854
p_int: 0.854260917
p_ni: 0.145739083
Score: 0.165
Data Source: BioPlex,STRINGDB
LPAR6
Tchem
Family: GPCR
Novelty: 0.02519993
p_int: 0.848628252
p_ni: 0.151371748
Score: 0.189
Data Source: BioPlex,STRINGDB
DLK1
Tchem
Novelty: 0.00168177
p_int: 0.81738252
p_ni: 0.18261748
Score: 0.189
Data Source: BioPlex,STRINGDB
DACT3
Tbio
Novelty: 0.01168094
p_int: 0.786307522
p_ni: 0.213692477
p_wrong: 2e-9
Data Source: BioPlex
SLC1A7
Tchem
Family: Transporter
Novelty: 0.00085139
Score: 0.876
Data Source: STRINGDB
SLC38A1
Tbio
Family: Transporter
Novelty: 0.01798433
Score: 0.822
Data Source: STRINGDB
SLC1A5
Tchem
Family: Transporter
Novelty: 0.00240958
Score: 0.815
Data Source: STRINGDB
SLC1A4
Tbio
Family: Transporter
Novelty: 0.01640877
Score: 0.798
Data Source: STRINGDB
SLC1A1
Tchem
Family: Transporter
Novelty: 0.00252834
Score: 0.793
Data Source: STRINGDB
Publication Statistics
PubMed Score  93.72

PubMed score by year
PubTator Score  73.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHPGT
1-70
TSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVHLLLKTANEGGSLLYEQLGYK
70-140
AFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIQALTNIEDKTGLWYLNGNYLVLLVSLVVILPLS
140-210
LFRNLGYLGYTSGLSLLCMVFFLIVVICKKFQVPCPVEAALIINETINTTLTQPTALVPALSHNVTENDS
210-280
CRPHYFIFNSQTVYAVPILIFSFVCHPAVLPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTF
280-350
YEHVESELLHTYSSILGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTHLLCASKDFSWWRHSLITVSI
350-420
LAFTNLLVIFVPTIRDIFGFIGASAASMLIFILPSAFYIKLVKKEPMKSVQKIGALFFLLSGVLVMTGSM
420-490
ALIVLDWVHNAPGGGH
490-506
MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVHLLLKTANEGGSLLYEQLGYKAFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIQALTNIEDKTGLWYLNGNYLVLLVSLVVILPLSLFRNLGYLGYTSGLSLLCMVFFLIVVICKKFQVPCPVEAALIINETINTTLTQPTALVPALSHNVTENDSCRPHYFIFNSQTVYAVPILIFSFVCHPAVLPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTFYEHVESELLHTYSSILGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTHLLCASKDFSWWRHSLITVSILAFTNLLVIFVPTIRDIFGFIGASAASMLIFILPSAFYIKLVKKEPMKSVQKIGALFFLLSGVLVMTGSMALIVLDWVHNAPGGGH