You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GSDMA
Gasdermin-A

Protein Summary
Description
May promote pyroptosis (Probable). Upon cleavage in vitro of genetically engineered GSDMA, the released N-terminal moiety binds to some types of lipids, such as possibly phosphatidylinositol (4,5)-bisphosphate. Homooligomerizes within the membrane and forms pores of 10 -15 nanometers (nm) of inner diameter, triggering cell death. Also binds to bacterial and mitochondrial lipids, including cardiolipin, and exhibits bactericidal activity (PubMed:27281216). The physiological relevance of these observations is unknown (Probable).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000301659
  • ENSP00000301659
  • ENSG00000167914
  • ENST00000635792
  • ENSP00000490739

Symbol
  • GSDM
  • GSDM1
  • GSDM
  • FKSG9
  • GSDM1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.59
phenotype
0.58
tissue
0.5
disease
0.47
gene perturbation
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 33.09   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 98   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 33.09   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 98   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (1)
Items per page:
1 – 1 of 1
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Hair Follicle Development: Cytodifferentiation (Part 3 of 3)
Name
Explore in Pharos
Explore in Source
Hair Follicle Development: Cytodifferentiation (Part 3 of 3)
Protein-Protein Interactions (45)
1 – 10 of 45
TEFM
Tbio
Novelty: 0.13341034
p_int: 0.990036302
p_ni: 0.009963698
Data Source: BioPlex
HES4
Tbio
Family: TF
Novelty: 0.10402777
p_int: 0.977457226
p_ni: 0.022542774
Data Source: BioPlex
ZIC1
Tbio
Family: TF
Novelty: 0.00309271
p_int: 0.966473707
p_ni: 0.033526293
Score: 0.198
Data Source: BioPlex,STRINGDB
TBC1D22B
Tbio
Novelty: 6
p_int: 0.948343436
p_ni: 0.051656561
p_wrong: 3e-9
Data Source: BioPlex
NDUFS5
Tclin
Family: Enzyme
Novelty: 0.59900166
p_int: 0.943973611
p_ni: 0.056026389
Data Source: BioPlex
ZSCAN12
Tdark
Family: TF
Novelty: 0.40909091
p_int: 0.927191258
p_ni: 0.072808742
Data Source: BioPlex
DDX19B
Tbio
Family: Enzyme
Novelty: 0.05099873
p_int: 0.860874656
p_ni: 0.139125344
Data Source: BioPlex
KLHL11
Tdark
Novelty: 0.39728266
p_int: 0.824565656
p_ni: 0.175434341
p_wrong: 2e-9
Data Source: BioPlex
GSDME
Tbio
Novelty: 0.01946224
Score: 0.807
Data Source: STRINGDB
ORMDL3
Tbio
Novelty: 0.01336886
Score: 0.764
Data Source: STRINGDB
Publication Statistics
PubMed Score  33.09

PubMed score by year
PubTator Score  12.88

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSP
1-70
SDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFL
70-140
KEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQL
140-210
MVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQS
210-280
SLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLL
280-350
VKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMW
350-420
DPDTLPRLCALYAGLSLLQQLTKAS
420-445
MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQLMVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS