You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RCHY1
RING finger and CHY zinc finger domain-containing protein 1

Protein Summary
Description
Mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, P73, HDAC1 and CDKN1B. Preferentially acts on tetrameric p53/TP53. Monoubiquitinates the translesion DNA polymerase POLH. Contributes to the regulation of the cell cycle progression. Increases AR transcription factor activity. The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jun 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000324439
  • ENSP00000321239
  • ENSG00000163743
  • ENST00000380840
  • ENSP00000370220
  • ENST00000505105
  • ENSP00000424631
  • ENST00000507014
  • ENSP00000424472
  • ENST00000512706
  • ENSP00000423976
  • ENST00000513257
  • ENSP00000421084

Symbol
  • ARNIP
  • CHIMP
  • PIRH2
  • RNF199
  • ZNF363
  • ZCHY
  • ARNIP
  • CHIMP
  • PIRH2
  • RNF199
  • ZNF363
  • PRO1996
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.87
microRNA
0.81
histone modification site profile
0.76
protein domain
0.73
cellular component
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 296.48   (req: < 5)
Gene RIFs: 38   (req: <= 3)
Antibodies: 174   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 296.48   (req: >= 5)
Gene RIFs: 38   (req: > 3)
Antibodies: 174   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (17)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen processing: Ubiquitination & Proteasome degradation
Reactome
Class I MHC mediated antigen processing & presentation
Reactome
DNA Damage Bypass
Reactome
DNA Repair
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen processing: Ubiquitination & Proteasome degradation
Class I MHC mediated antigen processing & presentation
DNA Damage Bypass
DNA Repair
Protein-Protein Interactions (355)
1 – 10 of 355
UBASH3B
Tbio
Novelty: 0.01852629
p_int: 0.999999995
p_ni: 5e-9
Score: 0.543
Data Source: BioPlex,STRINGDB
ALAS1
Tclin
Family: Enzyme
Novelty: 0.01508137
p_int: 0.999995947
p_ni: 0.000004053
Score: 0.345
Data Source: BioPlex,STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.989
Data Source: STRINGDB
HUWE1
Tbio
Family: Enzyme
Novelty: 0.00661087
Score: 0.967
Data Source: STRINGDB
UBE2D2
Tbio
Novelty: 0.00827182
Score: 0.961
Data Source: STRINGDB
TP73
Tbio
Family: TF
Novelty: 0.00899658
Score: 0.957
Data Source: STRINGDB
KLHL41
Tbio
Novelty: 0.04385859
Score: 0.954
Data Source: STRINGDB
POLH
Tchem
Family: Enzyme
Novelty: 0.00705977
Score: 0.952
Data Source: Reactome,STRINGDB
WWP1
Tbio
Family: Enzyme
Novelty: 0.01759787
Score: 0.946
Data Source: STRINGDB
RNF123
Tbio
Family: Enzyme
Novelty: 0.04581752
Score: 0.945
Data Source: STRINGDB
Publication Statistics
PubMed Score  296.48

PubMed score by year
PubTator Score  134.13

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQH
1-70
AQQTCEECSTLFGEYYCDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENV
70-140
SRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMP
140-210
SEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ
210-261
MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEYYCDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ