You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PGLYRP2
N-acetylmuramoyl-L-alanine amidase

Protein Summary
Description
May play a scavenger role by digesting biologically active peptidoglycan (PGN) into biologically inactive fragments. Has no direct bacteriolytic activity. This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and thus may play a scavenger role by digesting biologically active peptidoglycan into biologically inactive fragments. [provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000292609
  • ENSP00000292609
  • ENSG00000161031
  • ENST00000340880
  • ENSP00000345968

Symbol
  • PGLYRPL
  • PGRPL
  • tagL
  • PGRPL
  • PGRP-L
  • PGLYRPL
  • HMFT0141
  • TAGL-like
  • tagl-beta
  • tagL-alpha
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.77
molecular function
0.76
phenotype
0.58
cell type or tissue
0.5
cell line
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.02   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 90   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.02   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 90   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Antimicrobial peptides (R-HSA-6803157)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Antimicrobial peptides
Reactome
Immune System
Reactome
Innate Immune System
Name
Explore in Pharos
Explore in Source
Antimicrobial peptides
Immune System
Innate Immune System
Protein-Protein Interactions (37)
1 – 10 of 37
MITD1
Tbio
Novelty: 0.53503185
Score: 0.713
Data Source: STRINGDB
AKAP17A
Tbio
Family: Enzyme
Novelty: 0.01392057
Score: 0.682
Data Source: STRINGDB
EVI5L
Tbio
Novelty: 1.27659574
Score: 0.678
Data Source: STRINGDB
TXNDC9
Tbio
Novelty: 0.00444155
Score: 0.644
Data Source: STRINGDB
NOD2
Tclin
Novelty: 0.00070751
Score: 0.641
Data Source: STRINGDB
TMEM121
Tdark
Novelty: 0.3880597
Score: 0.626
Data Source: STRINGDB
SPG7
Tbio
Family: Enzyme
Novelty: 0.00141214
Score: 0.623
Data Source: STRINGDB
IDS
Tbio
Family: Enzyme
Novelty: 0.0090788
Score: 0.604
Data Source: STRINGDB
CRNN
Tbio
Novelty: 0.02535031
Score: 0.574
Data Source: STRINGDB
TECR
Tbio
Family: Enzyme
Novelty: 0.00220663
Score: 0.572
Data Source: STRINGDB
Publication Statistics
PubMed Score  36.02

PubMed score by year
PubTator Score  18.62

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNSGPHNRLYHFL
1-70
LGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINL
70-140
PLDSMAAPWETGDTFPDVVAIAPDVRATSSPGLRDGSPDVTTADIGANTPDATKGCPDVQASLPDAKAKS
140-210
PPTMVDSLLAVTLAGNLGLTFLRGSQTQSHPDLGTEGCWDQLSAPRTFTLLDPKASLLTMAFLNGALDGV
210-280
ILGDYLSRTPEPRPSLSHLLSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVH
280-350
LQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCT
350-420
DFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAAL
420-490
PTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKR
490-560
SRREPPPRTLPATDLQ
560-576
MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNSGPHNRLYHFLLGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINLPLDSMAAPWETGDTFPDVVAIAPDVRATSSPGLRDGSPDVTTADIGANTPDATKGCPDVQASLPDAKAKSPPTMVDSLLAVTLAGNLGLTFLRGSQTQSHPDLGTEGCWDQLSAPRTFTLLDPKASLLTMAFLNGALDGVILGDYLSRTPEPRPSLSHLLSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCTDFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAALPTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKRSRREPPPRTLPATDLQ