You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
GPR82
Probable G-protein coupled receptor 82

Protein Summary
Description
Orphan receptor. The protein encoded by this gene is an orphan G protein-coupled receptor of unknown function. The encoded protein is a member of a family of proteins that contain seven transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. [provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000302548
  • ENSP00000303549
  • ENSG00000171657
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.75
cell type or tissue
0.67
cell line
0.52
microRNA
0.48
tissue
0.44


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.16   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 140   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.16   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 140   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (31)
1 – 10 of 31
EFHC2
Tbio
Novelty: 0.12433393
Score: 0.834
Data Source: STRINGDB
GPR142
Tchem
Family: GPCR
Novelty: 0.09709117
Score: 0.71
Data Source: STRINGDB
CASK
Tchem
Family: Kinase
Novelty: 0.0064209
Score: 0.654
Data Source: STRINGDB
GPR162
Tbio
Family: GPCR
Novelty: 0.1214531
Score: 0.634
Data Source: STRINGDB
GPR27
Tdark
Family: GPCR
Novelty: 0.22950594
Score: 0.605
Data Source: STRINGDB
GPR15
Tbio
Family: GPCR
Novelty: 0.00385123
Score: 0.575
Data Source: STRINGDB
GPR52
Tchem
Family: GPCR
Novelty: 0.17696184
Score: 0.573
Data Source: STRINGDB
GPR26
Tbio
Family: GPCR
Novelty: 0.2224922
Score: 0.561
Data Source: STRINGDB
GPR150
Tdark
Family: GPCR
Novelty: 1.61864462
Score: 0.559
Data Source: STRINGDB
GPR61
Tbio
Family: GPCR
Novelty: 0.19525282
Score: 0.54
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.16

PubMed score by year
PubTator Score  0.46

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MNNNTTCIQPSMISSMALPIIYILLCIVGVFGNTLSQWIFLTKIGKKTSTHIYLSHLVTANLLVCSAMPF
1-70
MSIYFLKGFQWEYQSAQCRVVNFLGTLSMHASMFVSLLILSWIAISRYATLMQKDSSQETTSCYEKIFYG
70-140
HLLKKFRQPNFARKLCIYIWGVVLGIIIPVTVYYSVIEATEGEESLCYNRQMELGAMISQIAGLIGTTFI
140-210
GFSFLVVLTSYYSFVSHLRKIRTCTSIMEKDLTYSSVKRHLLVIQILLIVCFLPYSIFKPIFYVLHQRDN
210-280
CQQLNYLIETKNILTCLASARSSTDPIIFLLLDKTFKKTLYNLFTKSNSAHMQSYG
280-336
MNNNTTCIQPSMISSMALPIIYILLCIVGVFGNTLSQWIFLTKIGKKTSTHIYLSHLVTANLLVCSAMPFMSIYFLKGFQWEYQSAQCRVVNFLGTLSMHASMFVSLLILSWIAISRYATLMQKDSSQETTSCYEKIFYGHLLKKFRQPNFARKLCIYIWGVVLGIIIPVTVYYSVIEATEGEESLCYNRQMELGAMISQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSIMEKDLTYSSVKRHLLVIQILLIVCFLPYSIFKPIFYVLHQRDNCQQLNYLIETKNILTCLASARSSTDPIIFLLLDKTFKKTLYNLFTKSNSAHMQSYG