You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GPR137
Integral membrane protein GPR137

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000313074
  • ENSP00000321698
  • ENSG00000173264
  • ENST00000377702
  • ENSP00000366931
  • ENST00000411458
  • ENSP00000411827
  • ENST00000438980
  • ENSP00000415698
  • ENST00000539851
  • ENSP00000442792

Symbol
  • C11orf4
  • GPR137A
  • TM7SF1L1
  • C11orf4
  • GPR137A
  • TM7SF1L1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor
0.74
tissue sample
0.71
small molecule perturbation
0.68
cell type or tissue
0.62
transcription factor binding site profile
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.98   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 166   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.98   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 166   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (21)
1 – 10 of 21
IPPK
Tbio
Family: Enzyme
Novelty: 0.04063664
p_int: 0.995316444
p_ni: 0.000003589
p_wrong: 0.004679967
Score: 0.197
Data Source: BioPlex,STRINGDB
LPAR1
Tchem
Family: GPCR
Novelty: 0.004102
p_int: 0.951493886
p_ni: 0.000076223
p_wrong: 0.048429891
Score: 0.203
Data Source: BioPlex,STRINGDB
DPEP1
Tclin
Family: Enzyme
Novelty: 0.0033193
p_int: 0.762169187
p_ni: 0.00006833
p_wrong: 0.237762483
Score: 0.177
Data Source: BioPlex,STRINGDB
GPR108
Tbio
Novelty: 0.52173913
Score: 0.662
Data Source: STRINGDB
GPR107
Tbio
Family: GPCR
Novelty: 0.26837061
Score: 0.571
Data Source: STRINGDB
GPR135
Tbio
Family: GPCR
Novelty: 0.36229019
Score: 0.54
Data Source: STRINGDB
OR6V1
Tdark
Family: oGPCR
Novelty: 6
Score: 0.532
Data Source: STRINGDB
OR51E2
Tbio
Family: oGPCR
Novelty: 0.03736893
Score: 0.505
Data Source: STRINGDB
GPRC5C
Tdark
Family: GPCR
Novelty: 0.19417476
Score: 0.476
Data Source: STRINGDB
TM7SF3
Tdark
Novelty: 0.23684211
Score: 0.464
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.98

PubMed score by year
PubTator Score  11.89

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MESNLSGLVPAAGLVPALPPAVTLGLTAAYTTLYALLFFSVYAQLWLVLLYGHKRLSYQTVFLALCLLWA
1-70
ALRTTLFSFYFRDTPRANRLGPLPFWLLYCCPVCLQFFTLTLMNLYFAQVVFKAKVKRRPEMSRGLLAVR
70-140
GAFVGASLLFLLVNVLCAVLSHRRRAQPWALLLVRVLVSDSLFVICALSLAACLCLVARRAPSTSIYLEA
140-210
KGTSVCQAAAMGGAMVLLYASRACYNLTALALAPQSRLDTFDYDWYNVSDQADLVNDLGNKGYLVFGLIL
210-280
FVWELLPTTLLVGFFRVHRPPQDLSTSHILNGQVFASRSYFFDRAGHCEDEGCSWEHSRGESTRCQDQAA
280-350
TTTVSTPPHRRDPPPSPTEYPGPSPPHPRPLCQVCLPLLAQDPGGRGYPLLWPAPCCSCHSELVPSP
350-417
MESNLSGLVPAAGLVPALPPAVTLGLTAAYTTLYALLFFSVYAQLWLVLLYGHKRLSYQTVFLALCLLWAALRTTLFSFYFRDTPRANRLGPLPFWLLYCCPVCLQFFTLTLMNLYFAQVVFKAKVKRRPEMSRGLLAVRGAFVGASLLFLLVNVLCAVLSHRRRAQPWALLLVRVLVSDSLFVICALSLAACLCLVARRAPSTSIYLEAKGTSVCQAAAMGGAMVLLYASRACYNLTALALAPQSRLDTFDYDWYNVSDQADLVNDLGNKGYLVFGLILFVWELLPTTLLVGFFRVHRPPQDLSTSHILNGQVFASRSYFFDRAGHCEDEGCSWEHSRGESTRCQDQAATTTVSTPPHRRDPPPSPTEYPGPSPPHPRPLCQVCLPLLAQDPGGRGYPLLWPAPCCSCHSELVPSP