You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ADAD1
Adenosine deaminase domain-containing protein 1

Protein Classes
Protein Summary
Description
Plays a role in spermatogenesis. Binds to RNA but not to DNA (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296513
  • ENSP00000296513
  • ENSG00000164113
  • ENST00000388724
  • ENSP00000373376
  • ENST00000388725
  • ENSP00000373377

Symbol
  • TENR
  • Tenr
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.91
disease
0.68
phenotype
0.67
cell type or tissue
0.61
cell line
0.51


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.56   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 59   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.56   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 59   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (52)
1 – 10 of 52
KIAA1109
Tbio
Novelty: 0.00235132
Score: 0.757
Data Source: STRINGDB
ARL9
Tdark
Family: Enzyme
Novelty: 2.625
Score: 0.662
Data Source: STRINGDB
TMEM33
Tbio
Novelty: 0.21582734
Score: 0.66
Data Source: STRINGDB
ANKRD50
Tdark
Novelty: 1.68674699
Score: 0.645
Data Source: STRINGDB
LGALS1
Tchem
Novelty: 0.00134398
Score: 0.642
Data Source: STRINGDB
MYO9B
Tbio
Novelty: 0.01975083
Score: 0.622
Data Source: STRINGDB
MEIOC
Tdark
Novelty: 0.6
Score: 0.592
Data Source: STRINGDB
NAA25
Tbio
Family: Enzyme
Novelty: 0.08199196
Score: 0.563
Data Source: STRINGDB
TAPT1
Tdark
Novelty: 0.23952096
Score: 0.545
Data Source: STRINGDB
LONRF2
Tdark
Family: Enzyme
Novelty: 2.93023256
Score: 0.539
Data Source: STRINGDB
Publication Statistics
PubMed Score  24.56

PubMed score by year
PubTator Score  5.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASNNHWFQSSQVPSFAQMLKKNLPVQPATKTITTPTGWSSESYGLSKMASKVTQVTGNFPEPLLSKNLS
1-70
SISNPVLPPKKIPKEFIMKYKRGEINPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQYK
70-140
TGLGQNKKESRSNAAKLALDELLQLDEPEPRILETSGPPPFPAEPVVLSELAYVSKVHYEGRHIQYAKIS
140-210
QIVKERFNQLISNRSEYLKYSSSLAAFIIERAGQHEVVAIGTGEYNYSQDIKPDGRVLHDTHAVVTARRS
210-280
LLRYFYRQLLLFYSKNPAMMEKSIFCTEPTSNLLTLKQNINICLYMNQLPKGSAQIKSQLRLNPHSISAF
280-350
EANEELCLHVAVEGKIYLTVYCPKDGVNRISSMSSSDKLTRWEVLGVQGALLSHFIQPVYISSILIGDGN
350-420
CSDTRGLEIAIKQRVDDALTSKLPMFYLVNRPHISLVPSAYPLQMNLEYKFLSLNWAQGDVSLEIVDGLS
420-490
GKITESSPFKSGMSMASRLCKAAMLSRFNLLAKEAKKELLEAGTYHAAKCMSASYQEAKCKLKSYLQQHG
490-560
YGSWIVKSPCIEQFNM
560-576
MASNNHWFQSSQVPSFAQMLKKNLPVQPATKTITTPTGWSSESYGLSKMASKVTQVTGNFPEPLLSKNLSSISNPVLPPKKIPKEFIMKYKRGEINPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQYKTGLGQNKKESRSNAAKLALDELLQLDEPEPRILETSGPPPFPAEPVVLSELAYVSKVHYEGRHIQYAKISQIVKERFNQLISNRSEYLKYSSSLAAFIIERAGQHEVVAIGTGEYNYSQDIKPDGRVLHDTHAVVTARRSLLRYFYRQLLLFYSKNPAMMEKSIFCTEPTSNLLTLKQNINICLYMNQLPKGSAQIKSQLRLNPHSISAFEANEELCLHVAVEGKIYLTVYCPKDGVNRISSMSSSDKLTRWEVLGVQGALLSHFIQPVYISSILIGDGNCSDTRGLEIAIKQRVDDALTSKLPMFYLVNRPHISLVPSAYPLQMNLEYKFLSLNWAQGDVSLEIVDGLSGKITESSPFKSGMSMASRLCKAAMLSRFNLLAKEAKKELLEAGTYHAAKCMSASYQEAKCKLKSYLQQHGYGSWIVKSPCIEQFNM