You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MRGPRX1
Mas-related G-protein coupled receptor member X1

Protein Summary
Description
Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Potently activated by enkephalins including BAM22 (bovine adrenal medulla peptide 22) and BAM (8-22)(PubMed:26582731). BAM22 is the most potent compound and evoked a large and dose-dependent release of intracellular calcium in stably transfected cells. G(alpha)q proteins are involved in the calcium-signaling pathway. Activated by the antimalarial drug, chloroquine. May mediate chloroquine-induced itch, in a histamine-independent manner.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000302797
  • ENSP00000305766
  • ENSG00000170255

Symbol
  • MRGX1
  • SNSR3
  • SNSR4
  • GPCR
  • MGRG2
  • MRGX1
  • SNSR4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.54
cell type or tissue
0.49
metabolite
0.45
transcription factor
0.44
protein domain
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.16   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 113   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.16   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 113   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (17)
1 – 10 of 17
NPFF
Tbio
Novelty: 0.00350925
Score: 0.747
Data Source: STRINGDB
GRP
Tbio
Novelty: 0.00039263
Score: 0.711
Data Source: STRINGDB
AP1B1
Tbio
Novelty: 0.03313791
Score: 0.684
Data Source: STRINGDB
MORF4L2
Tbio
Novelty: 0.13546248
Score: 0.54
Data Source: STRINGDB
PDYN
Tbio
Novelty: 0.00033852
Score: 0.533
Data Source: STRINGDB
NPS
Tbio
Novelty: 0.00011983
Score: 0.527
Data Source: STRINGDB
GPR42
Tdark
Family: GPCR
Novelty: 0.75
Score: 0.511
Data Source: STRINGDB
GNAQ
Tbio
Novelty: 0.00176666
Score: 0.451
Data Source: STRINGDB
PENK
Tbio
Novelty: 0.00085036
Score: 0.449
Data Source: STRINGDB
GNAI2
Tbio
Novelty: 0.04542644
Score: 0.445
Data Source: STRINGDB
Publication Statistics
PubMed Score  19.16

PubMed score by year
PubTator Score  18.18

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MDPTISTLDTELTPINGTEETLCYKQTLSLTVLTCIVSLVGLTGNAVVLWLLGCRMRRNAFSIYILNLAA
1-70
ADFLFLSGRLIYSLLSFISIPHTISKILYPVMMFSYFAGLSFLSAVSTERCLSVLWPIWYRCHRPTHLSA
70-140
VVCVLLWALSLLRSILEWMLCGFLFSGADSAWCQTSDFITVAWLIFLCVVLCGSSLVLLIRILCGSRKIP
140-210
LTRLYVTILLTVLVFLLCGLPFGIQFFLFLWIHVDREVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQ
210-280
RQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ
280-322
MDPTISTLDTELTPINGTEETLCYKQTLSLTVLTCIVSLVGLTGNAVVLWLLGCRMRRNAFSIYILNLAAADFLFLSGRLIYSLLSFISIPHTISKILYPVMMFSYFAGLSFLSAVSTERCLSVLWPIWYRCHRPTHLSAVVCVLLWALSLLRSILEWMLCGFLFSGADSAWCQTSDFITVAWLIFLCVVLCGSSLVLLIRILCGSRKIPLTRLYVTILLTVLVFLLCGLPFGIQFFLFLWIHVDREVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ