You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MRGPRX2
Mas-related G-protein coupled receptor member X2

Protein Summary
Description
Mast cell-specific receptor for basic secretagogues, i.e. cationic amphiphilic drugs, as well as endo- or exogenous peptides, consisting of a basic head group and a hydrophobic core (PubMed:25517090). Recognizes and binds small molecules containing a cyclized tetrahydroisoquinoline (THIQ), such as non-steroidal neuromuscular blocking drugs (NMBDs), including tubocurarine and atracurium. In response to these compounds, mediates pseudo-allergic reactions characterized by histamine release, inflammation and airway contraction (By similarity). Acts as a receptor for a number of other ligands, including peptides and alkaloids, such as cortistatin-14, proadrenomedullin N-terminal peptides PAMP-12 and, at lower extent, PAMP-20, antibacterial protein LL-37, PMX-53 peptide, beta-defensins, and complanadine A.
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.88
protein domain
0.58
cell type or tissue
0.56
biological process
0.46
ligand (protein)
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 52.93   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 269   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 52.93   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 269   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 4
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (15)
1 – 10 of 15
CORT
Tbio
Novelty: 0.0034818
Score: 0.787
Data Source: STRINGDB
NPFF
Tbio
Novelty: 0.00350925
Score: 0.754
Data Source: STRINGDB
MORF4L2
Tbio
Novelty: 0.13546248
Score: 0.672
Data Source: STRINGDB
AP1B1
Tbio
Novelty: 0.03313791
Score: 0.666
Data Source: STRINGDB
SUSD3
Tdark
Novelty: 1
Score: 0.575
Data Source: STRINGDB
NPS
Tbio
Novelty: 0.00011983
Score: 0.54
Data Source: STRINGDB
GHSR
Tclin
Family: GPCR
Novelty: 0.0018607
Score: 0.527
Data Source: STRINGDB
CAMP
Tbio
Novelty: 0.00089449
Score: 0.448
Data Source: STRINGDB
SST
Tbio
Novelty: 0.0000732
Score: 0.444
Data Source: STRINGDB
TAC1
Tbio
Novelty: 0.00007711
Score: 0.44
Data Source: STRINGDB
Publication Statistics
PubMed Score  52.93

PubMed score by year
PubTator Score  47.71

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLS
1-70
LAGADFLFLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTERCLSVLWPIWYRCR
70-140
RPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVLCGSSLALLVRIL
140-210
CGSRGLPLTRLYLTILLTVLVFLLCGLPFGIQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYF
210-280
FVGSFRKQWRLQQPILKLALQRALQDIAEVDHSEGCFRQGTPEMSRSSLV
280-330
MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLSLAGADFLFLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTERCLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFGIQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLALQRALQDIAEVDHSEGCFRQGTPEMSRSSLV